Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mirvetuximab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Mirvetuximab ELISA Kit

Mirvetuximab ELISA Kit

Product name Mirvetuximab ELISA Kit
Uniprot ID P15328
Raw Antigen Sequence MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHFIQDTCLYECSPNLGPWIQQVDQSWRKERVLNVPLCKEDCEQWWEDCRTSYTCKSNWHKGWNWTSGFNKCAVGAACQPFHFYFPTPTVLCNEIWTHSYKVSNYSRGSGRCIQMWFDPAQGNPNEEVARFYAAAMSGAGPWAAWPFLLSLALMLLWLLS
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX186
Note For research use only.
Sample type Plasma, Serum
Target Mirvetuximab
Immunogen Mirvetuximab

The Structure of Mirvetuximab ELISA Kit

Mirvetuximab ELISA Kit is a specialized diagnostic tool used in the detection of the monoclonal antibody, mirvetuximab. This antibody is a humanized IgG1 monoclonal antibody that specifically targets folate receptor alpha (FRα), a protein that is highly expressed in various types of cancer cells.

The Mirvetuximab ELISA Kit is composed of several components that work together to accurately detect the presence of mirvetuximab in a sample. These components include a microplate coated with FRα, a mirvetuximab-specific enzyme conjugate, a substrate solution, and a stop solution. The microplate is divided into wells, each of which is coated with FRα. The enzyme conjugate is a specialized protein that binds to mirvetuximab and produces a color change when it comes in contact with the substrate solution. The stop solution is used to halt the reaction and allow for the measurement of the color intensity, which is directly proportional to the amount of mirvetuximab present in the sample.

The Activity of Mirvetuximab ELISA Kit

The Mirvetuximab ELISA Kit works by utilizing the principle of enzyme-linked immunosorbent assay (ELISA). This technique involves the use of an enzyme-labeled antibody to detect the presence of a specific target molecule, in this case, mirvetuximab. The enzyme conjugate is added to the sample and allowed to bind to any mirvetuximab present. After a series of washing steps, the substrate solution is added, which causes a color change in the presence of the enzyme conjugate. The intensity of the color is measured using a spectrophotometer and is directly proportional to the amount of mirvetuximab present in the sample.

The Mirvetuximab ELISA Kit has a high sensitivity and specificity, making it a reliable tool for the detection of mirvetuximab. It has a detection limit of 0.1 ng/mL, which means it can detect very low levels of mirvetuximab in a sample. This makes it useful for monitoring the levels of mirvetuximab in patients undergoing treatment with this antibody.

The Application of Mirvetuximab ELISA Kit

The primary application of Mirvetuximab ELISA Kit is in the clinical setting for the detection and monitoring of mirvetuximab levels in patients. Mirvetuximab is currently being investigated as a potential therapeutic agent for various types of cancer, including ovarian, lung, and breast cancer. As FRα is highly expressed in these types of cancer cells, mirvetuximab specifically targets and binds to these cells, leading to their destruction.

The Mirvetuximab ELISA Kit can also be used in research settings to study the pharmacokinetics and pharmacodynamics of mirvetuximab. It can be used to determine the optimal dosage and dosing schedule for mirvetuximab, as well as to monitor its efficacy in preclinical and clinical studies.

In addition, the Mirvetuximab ELISA Kit has potential applications in the biopharmaceutical industry for the quality control of mirvetuximab production. It can be used to ensure the purity and potency of mirvetuximab batches, which is crucial for its effectiveness as a therapeutic agent.

Conclusion

The Mirvetuximab ELISA Kit is a valuable tool for the detection and monitoring of mirvetuximab levels in patients. Its high sensitivity and specificity make it a reliable diagnostic tool for use in clinical and research settings. With the potential of mirvetuximab as a therapeutic agent for various types of cancer, the Mirvetuximab ELISA Kit plays a crucial role in its development and application in the field of oncology.

Mirvetuximab ELISA Kit

There are no reviews yet.

Be the first to review “Mirvetuximab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products