Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Certolizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Certolizumab ELISA Kit

Certolizumab ELISA Kit

Product name Certolizumab ELISA Kit
Uniprot ID P01375
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX128
Note For research use only.
Sample type Plasma, Serum
Target Certolizumab
Immunogen Certolizumab

Introduction

Certolizumab is a monoclonal antibody that has been developed as a therapeutic agent for the treatment of various inflammatory diseases, including rheumatoid arthritis, Crohn’s disease, and psoriasis. The use of Certolizumab as a therapeutic agent has gained significant attention due to its high specificity and efficacy in targeting inflammatory pathways. The Certolizumab ELISA kit is a valuable tool for measuring the levels of Certolizumab in biological samples, providing researchers and clinicians with crucial information about the drug’s activity and efficacy.

Structure of Certolizumab

Certolizumab is a humanized monoclonal antibody that belongs to the immunoglobulin G1 (IgG1) subclass. It is composed of two heavy chains and two light chains, each containing a variable and constant region. The variable region of Certolizumab is responsible for its specificity, as it binds specifically to tumor necrosis factor alpha (TNF-α), a pro-inflammatory cytokine involved in the pathogenesis of various inflammatory diseases. The constant region of Certolizumab is responsible for its effector functions, such as antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Certolizumab

Certolizumab exerts its therapeutic activity by binding to TNF-α and preventing its interaction with its receptors on the cell surface. This inhibits the downstream signaling pathways that lead to inflammation, thereby reducing the symptoms of inflammatory diseases. Additionally, Certolizumab can also induce apoptosis (cell death) of TNF-α-producing cells, further reducing the levels of this pro-inflammatory cytokine in the body.

Application of Certolizumab ELISA Kit

The Certolizumab ELISA kit is a valuable tool for measuring the levels of Certolizumab in biological samples, including serum, plasma, and tissue homogenates. This information is crucial for monitoring the drug’s activity and efficacy in patients undergoing treatment. The Certolizumab ELISA kit is also used in preclinical studies to determine the pharmacokinetics (PK) and pharmacodynamics (PD) of Certolizumab, providing researchers with valuable insights into the drug’s behavior in the body.

Measurement of Certolizumab Levels

The Certolizumab ELISA kit utilizes a sandwich enzyme-linked immunosorbent assay (ELISA) format, with a specific anti-Certolizumab antibody coated on the microplate. The sample containing Certolizumab is added to the microplate, followed by a detection antibody that binds to Certolizumab. The amount of Certolizumab is then quantified by adding a substrate that produces a colorimetric signal, which is measured using a spectrophotometer. The intensity of the color is directly proportional to the amount of Certolizumab present in the sample.

Benefits of Certolizumab ELISA Kit

The Certolizumab ELISA kit offers several advantages over other methods of measuring Certolizumab levels. It is a highly sensitive and specific assay, with a lower limit of detection of 0.1 ng/mL. It also has a wide dynamic range, allowing for the quantification of Certolizumab levels in both high and low concentrations. The Certolizumab ELISA kit is also easy to use, with a short assay time of 2-3 hours, making it suitable for high-throughput applications.

Clinical Significance

The Certolizumab ELISA kit has significant clinical significance, as it provides crucial information about the drug’s activity and efficacy in patients undergoing treatment. It can help clinicians monitor the drug’s levels in the body, ensuring that patients are receiving the correct dose and that the drug is effectively targeting the inflammatory pathways. The Certolizumab ELISA kit can also aid in

Certolizumab ELISA Kit

There are no reviews yet.

Be the first to review “Certolizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products