Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tibulizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Tibulizumab ELISA Kit

Tibulizumab ELISA Kit

Product name Tibulizumab ELISA Kit
Uniprot ID Q16552 & Q9Y275
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX262
Note For research use only.
Sample type Plasma, Serum
Target Tibulizumab
Immunogen Tibulizumab

Introduction to Tibulizumab ELISA Kit

Tibulizumab is a humanized monoclonal antibody that has shown promising results in the treatment of various cancers and autoimmune diseases. It is designed to target a specific protein known as CD6, which is found on the surface of T cells. CD6 plays a crucial role in T cell activation and proliferation, making it an attractive therapeutic target for conditions involving abnormal immune responses. The Tibulizumab ELISA Kit is a valuable tool for researchers and clinicians to measure the levels of Tibulizumab in various biological samples.

Structure of Tibulizumab

Tibulizumab is a recombinant humanized IgG1 monoclonal antibody, meaning it is derived from human antibodies and has been modified to reduce its immunogenicity. It consists of two heavy chains and two light chains, connected by disulfide bonds. The variable regions of the antibody are responsible for binding to the CD6 protein, while the constant region mediates effector functions such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Tibulizumab

Tibulizumab exerts its therapeutic effects by binding to CD6 on the surface of T cells. This prevents the interaction between CD6 and its ligand, CD166, which is essential for T cell activation and proliferation. By blocking this interaction, Tibulizumab inhibits the activation and proliferation of T cells, leading to a decrease in the inflammatory response. This mechanism of action has shown promising results in the treatment of autoimmune diseases such as rheumatoid arthritis and psoriasis, as well as various types of cancer.

Application of Tibulizumab ELISA Kit

The Tibulizumab ELISA Kit is a valuable tool for monitoring the levels of Tibulizumab in biological samples. It utilizes the principle of enzyme-linked immunosorbent assay (ELISA) to detect and quantify the amount of Tibulizumab present. The kit contains all the necessary reagents and materials, including Tibulizumab-specific antibodies, for accurate and sensitive measurement of Tibulizumab levels.

The Tibulizumab ELISA Kit has a wide range of applications in both research and clinical settings. In research, it is used to measure the pharmacokinetics of Tibulizumab, which refers to the absorption, distribution, metabolism, and excretion of the drug in the body. This information is crucial for determining the optimal dosage and dosing frequency of Tibulizumab. Additionally, the kit can be used to assess the efficacy of Tibulizumab in clinical trials by measuring the levels of the drug in patients’ blood samples.

In clinical settings, the Tibulizumab ELISA Kit is used for therapeutic drug monitoring (TDM). TDM involves measuring the levels of a drug in a patient’s blood to ensure that it is within the therapeutic range. This is especially important for drugs with a narrow therapeutic window, such as Tibulizumab, where too little or too much of the drug can lead to suboptimal treatment outcomes or adverse effects. TDM can also help clinicians adjust the dosage of Tibulizumab to achieve optimal therapeutic levels in each patient.

Conclusion

The Tibulizumab ELISA Kit is a valuable tool for measuring the levels of Tibulizumab in various biological samples. Its accurate and sensitive detection of Tibulizumab makes it an essential component in research and clinical settings. By targeting CD6, Tibulizumab has shown promising results in the treatment of various diseases, and the Tibulizumab ELISA Kit plays a crucial role in monitoring its levels for optimal therapeutic outcomes.

Tibulizumab ELISA Kit

There are no reviews yet.

Be the first to review “Tibulizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products