Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tibulizumab Biosimilar – Anti-IL17A, TNFSF13B, CD257 mAb – Research Grade

  • PX-TA1494-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG4-kappa-[scFv]2

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade

Product name Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade
Uniprot ID Q16552 & Q9Y275
Source CAS 1849636-24-3
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Tibulizumab,LY 3090106,LY-3090106,LY3090106,IL17A, TNFSF13B, CD257,anti-IL17A, TNFSF13B, CD257
Reference PX-TA1494
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa-[scFv]2
Clonality Monoclonal Antibody
Product name Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade
Uniprot ID Q16552 & Q9Y275
Source CAS 1849636-24-3
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Tibulizumab,LY 3090106,LY-3090106,LY3090106,IL17A, TNFSF13B, CD257,anti-IL17A, TNFSF13B, CD257
Reference PX-TA1494
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa-[scFv]2
Clonality Monoclonal Antibody
Product name PX-TA1494-50
Uniprot ID Q16552 & Q9Y275
Source CAS 1849636-24-3
Species Humanized
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Tibulizumab,LY 3090106,LY-3090106,LY3090106,IL17A, TNFSF13B, CD257,anti-IL17A, TNFSF13B, CD257
Reference PX-TA1494
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa-[scFv]2
Clonality Monoclonal Antibody

Introduction to Tibulizumab Biosimilar – Anti-IL17A, TNFSF13B, CD257 mAb

Tibulizumab Biosimilar is a monoclonal antibody (mAb) that specifically targets three important proteins – IL17A, TNFSF13B, and CD257. This biosimilar is a research grade antibody that has shown promising results in various pre-clinical studies. In this article, we will delve into the structure, activity and potential applications of Tibulizumab Biosimilar.

Structure of Tibulizumab Biosimilar

Tibulizumab Biosimilar is a fully humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The antibody binds to its target proteins through its variable regions, which are specific for IL17A, TNFSF13B, and CD257. The constant regions of the antibody play a crucial role in mediating its effector functions.

Activity of Tibulizumab Biosimilar

IL17A, TNFSF13B, and CD257 are all important cytokines involved in various inflammatory and immune responses. IL17A is a pro-inflammatory cytokine that plays a key role in the pathogenesis of autoimmune diseases such as rheumatoid arthritis, psoriasis, and multiple sclerosis. TNFSF13B, also known as B-cell activating factor (BAFF), is a cytokine that promotes B-cell survival and differentiation. CD257, also known as B-cell maturation antigen (BCMA), is a protein expressed on the surface of B-cells and plays a crucial role in regulating B-cell function.

Tibulizumab Biosimilar targets all three of these proteins and inhibits their activity. By blocking IL17A, TNFSF13B, and CD257, Tibulizumab Biosimilar can effectively suppress inflammation and modulate the immune response. This makes it a potential therapeutic option for various autoimmune diseases and other inflammatory conditions.

Applications of Tibulizumab Biosimilar

Due to its ability to target multiple cytokines, Tibulizumab Biosimilar has a wide range of potential applications. Some of the key therapeutic areas where this biosimilar can be used include:

1. Rheumatoid arthritis: As mentioned earlier, IL17A is a key player in the pathogenesis of rheumatoid arthritis. By targeting this cytokine, Tibulizumab Biosimilar can potentially alleviate the symptoms of this debilitating autoimmune disease.

2. Psoriasis: Psoriasis is another autoimmune disease where IL17A has been implicated. Clinical trials have shown that targeting IL17A with monoclonal antibodies can effectively treat psoriasis. Tibulizumab Biosimilar, with its specificity for IL17A, can be a promising treatment option for this condition.

3. Multiple sclerosis (MS): MS is a chronic inflammatory disease of the central nervous system (CNS). Studies have shown that TNFSF13B plays a role in the pathogenesis of MS. By targeting this cytokine, Tibulizumab Biosimilar can potentially slow down the progression of MS and improve patient outcomes.

4. B-cell malignancies: CD257 is highly expressed on the surface of B-cell malignancies such as multiple myeloma and chronic lymphocytic leukemia. Tibulizumab Biosimilar, by targeting CD257, can potentially induce apoptosis (cell death) in these cancer cells and inhibit their growth.

Conclusion

In summary, Tibulizumab Biosimilar is a research grade antibody that specifically targets IL17A, TNFSF13B, and CD257. Its unique structure and activity make it a promising therapeutic option for various autoimmune diseases, inflammatory conditions, and B-cell malignancies. Further research and clinical trials are needed to fully understand the potential of this biosimilar in treating these diseases.

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade binds to IL17A, C-His, recombinant protein in ELISA assay

Immobilized IL17A, C-His, recombinant protein (cat. No.PX-P5780) at 0.5µg/mL (100µL/well) can bind Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade (cat. No.PX-TA1494) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 129.6M.

SDS-PAGE for Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade

SDS-PAGE for Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tibulizumab Biosimilar - Anti-IL17A, TNFSF13B, CD257 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tibulizumab Biosimilar – Anti-IL17A, TNFSF13B, CD257 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products