Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Certolizumab Biosimilar – Anti-TNF-Alpha mAb – Research Grade

  • PX-TA1024-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
Fab'-G1-kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade

Product name Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB08904
Species Human
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 45kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Certolizumab,Certolizumab,TNF-Alpha,anti-TNF-Alpha
Reference PX-TA1024
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'G1Kappa
Clonality Monoclonal Antibody
Product name Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade
Uniprot ID P01375
Source DrugBank DB08904
Species Human
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 45kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Certolizumab,Certolizumab,TNF-Alpha,anti-TNF-Alpha
Reference PX-TA1024
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'G1Kappa
Clonality Monoclonal Antibody
Product name PX-TA1024-50
Uniprot ID P01375
Source DrugBank DB08904
Species Human
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Molecular weight 45kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Certolizumab,Certolizumab,TNF-Alpha,anti-TNF-Alpha
Reference PX-TA1024
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fab'-G1-kappa
Clonality Monoclonal Antibody

Certolizumab Biosimilar: A Promising Anti-TNF-Alpha mAb for Therapeutic Intervention Introduction

Certolizumab biosimilar is a monoclonal antibody (mAb) that has emerged as a promising therapeutic agent for the treatment of various inflammatory diseases. It belongs to the class of anti-TNF-alpha mAbs, which have shown significant efficacy in targeting and neutralizing the activity of tumor necrosis factor-alpha (TNF-alpha) in the body. In this article, we will discuss the structure, activity, and potential applications of Certolizumab biosimilar as a research grade antibody.

Structure of Certolizumab Biosimilar

Certolizumab biosimilar is a recombinant, humanized mAb that is derived from the parental antibody Certolizumab pegol. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The heavy chains are further divided into variable (VH) and constant (CH) regions, while the light chains consist of variable (VL) and constant (CL) regions. The VH and VL regions together form the antigen-binding fragment (Fab) of the antibody, while the CH and CL regions make up the crystallizable fragment (Fc).

Activity of Certolizumab Biosimilar

Certolizumab biosimilar exerts its therapeutic effect by specifically targeting and binding to TNF-alpha, a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various inflammatory conditions. By binding to TNF-alpha, Certolizumab biosimilar prevents its interaction with its receptors, thereby inhibiting downstream signaling pathways that lead to inflammation. This results in a reduction in the production of pro-inflammatory cytokines, chemokines, and adhesion molecules, and ultimately leads to a decrease in inflammation and disease activity.

Applications of Certolizumab Biosimilar

Certolizumab biosimilar has been extensively studied in various inflammatory diseases, including rheumatoid arthritis, psoriatic arthritis, ankylosing spondylitis, Crohn’s disease, and ulcerative colitis. In clinical trials, it has shown significant efficacy in reducing disease activity, improving symptoms, and preventing joint damage in patients with rheumatoid arthritis and psoriatic arthritis. In patients with ankylosing spondylitis, Certolizumab biosimilar has been shown to improve symptoms and physical function, and reduce radiographic progression of the disease. In inflammatory bowel diseases, it has demonstrated efficacy in inducing and maintaining remission, and improving quality of life.

Research Grade Antibody

Certolizumab biosimilar is available as a research grade antibody, which is primarily used for in vitro and in vivo studies to understand its mechanism of action and evaluate its potential as a therapeutic agent. It is also used for the development of biosimilar versions of Certolizumab pegol, which can help increase access to this important medication for patients with inflammatory diseases.

Conclusion

Certolizumab biosimilar is a promising anti-TNF-alpha mAb that has shown significant efficacy in targeting and neutralizing TNF-alpha, thereby reducing inflammation and disease activity in various inflammatory conditions. Its structure, activity, and potential applications make it a valuable research grade antibody for studying the role of TNF-alpha in disease pathogenesis and developing new therapeutic interventions. With further research and development, Certolizumab biosimilar has the potential to improve the lives of patients suffering from inflammatory diseases.

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade binds to Human TNFa Recombinant Protein in ELISA assay

Immobilized Human TNFa Recombinant Protein (cat. No.PX-P3058) at 0.5µg/mL (100µL/well) can bind Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade (cat. No.PX-TA1024) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 105.9M.

SDS-PAGE for Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade

SDS-PAGE for Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Certolizumab Biosimilar - Anti-TNF-Alpha mAb - Research Grade

There are no reviews yet.

Be the first to review “Certolizumab Biosimilar – Anti-TNF-Alpha mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products