Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vunakizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Vunakizumab ELISA Kit

Vunakizumab ELISA Kit

Product name Vunakizumab ELISA Kit
Uniprot ID Q16552
Raw Antigen Sequence MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX263
Note For research use only.
Sample type Plasma, Serum
Target Vunakizumab
Immunogen Vunakizumab

Introduction

Vunakizumab is a human monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various inflammatory and autoimmune diseases. The use of this antibody as a therapeutic target has been made possible by the development of an enzyme-linked immunosorbent assay (ELISA) kit, which allows for the accurate and sensitive detection of Vunakizumab in biological samples. In this article, we will discuss the structure, activity, and application of the Vunakizumab ELISA kit.

Structure of Vunakizumab

Vunakizumab is a fully human monoclonal antibody that belongs to the IgG1 subclass. It is composed of two heavy chains and two light chains, each of which contains a constant and a variable region. The variable region of the antibody is responsible for binding to its target, while the constant region determines its effector functions. The structure of Vunakizumab has been engineered to have a high affinity for its target, making it a potent therapeutic agent.

Activity of Vunakizumab

Vunakizumab has been shown to have a high specificity for its therapeutic target, which is the interleukin-6 (IL-6) cytokine. IL-6 is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of several diseases, including rheumatoid arthritis, psoriasis, and Crohn’s disease. By binding to IL-6, Vunakizumab inhibits its activity and prevents it from promoting inflammation. This mechanism of action makes Vunakizumab a promising therapeutic option for the treatment of various inflammatory and autoimmune diseases.

Application of Vunakizumab ELISA Kit

The Vunakizumab ELISA kit has been specifically designed to measure the levels of Vunakizumab in biological samples, such as serum, plasma, or tissue lysates. The kit utilizes a sandwich ELISA format, where the Vunakizumab antibody is used as both the capture and detection antibody. This allows for the accurate and sensitive detection of Vunakizumab in a wide range of sample types.

One of the main applications of the Vunakizumab ELISA kit is in clinical trials. As Vunakizumab is still in the early stages of development, the ELISA kit is used to monitor the levels of the antibody in patients receiving treatment. This allows researchers to determine the optimal dose and dosing frequency of Vunakizumab for maximum efficacy.

Another important application of the Vunakizumab ELISA kit is in pharmacokinetic studies. By measuring the levels of Vunakizumab in biological samples over time, researchers can gain insight into the absorption, distribution, metabolism, and elimination of the antibody in the body. This information is crucial for understanding the pharmacokinetics of Vunakizumab and for optimizing its dosing regimen.

In addition to its use in clinical trials and pharmacokinetic studies, the Vunakizumab ELISA kit can also be used in basic research. It allows researchers to study the expression and regulation of Vunakizumab in various disease models, providing valuable insights into the role of IL-6 in disease pathogenesis.

Conclusion

In summary, the Vunakizumab ELISA kit is an essential tool for the development and evaluation of Vunakizumab as a therapeutic agent. Its high specificity and sensitivity make it a valuable tool for monitoring Vunakizumab levels in clinical trials and pharmacokinetic studies. Furthermore, its application in basic research allows for a better understanding of the role of Vunakizumab in disease pathogenesis. With its potential to treat a wide range of inflammatory and autoimmune diseases, Vunakizumab and its accompanying ELISA kit hold great promise for improving patient outcomes.

Vunakizumab ELISA Kit

There are no reviews yet.

Be the first to review “Vunakizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products