Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Talacotuzumab Biosimilar – Anti-NOTCH2, NOTCH3 mAb – Research Grade

  • PX-TA1476-50
  • Validated WB
Clonality:
Monoclonal Antibody
Isotype:
IgG2, Kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Talacotuzumab Biosimilar - Anti-NOTCH2, NOTCH3 mAb - Research Grade

Product name Talacotuzumab Biosimilar - Anti-NOTCH2, NOTCH3 mAb - Research Grade
Uniprot ID P26951
Source CAS 1826831-79-1
Species Homo sapiens
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Talacotuzumab,CSL-362-AML,CSL362,JNJ-56022473,NOTCH2, NOTCH3,anti-NOTCH2, NOTCH3
Reference PX-TA1476
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name Talacotuzumab Biosimilar - Anti-NOTCH2, NOTCH3 mAb - Research Grade
Uniprot ID P26951
Source CAS 1826831-79-1
Species Homo sapiens
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Talacotuzumab,CSL-362-AML,CSL362,JNJ-56022473,NOTCH2, NOTCH3,anti-NOTCH2, NOTCH3
Reference PX-TA1476
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2-kappa
Clonality Monoclonal Antibody
Product name PX-TA1476-50
Uniprot ID P26951
Source CAS 1826831-79-1
Species Homo sapiens
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Talacotuzumab,CSL-362-AML,CSL362,JNJ-56022473,NOTCH2, NOTCH3,anti-NOTCH2, NOTCH3
Reference PX-TA1476
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG2, Kappa
Clonality Monoclonal Antibody

Introduction

Talacotuzumab Biosimilar, also known as Anti-NOTCH2, NOTCH3 monoclonal antibody (mAb) – Research Grade, is a novel therapeutic agent that targets the NOTCH2 and NOTCH3 receptors. This biosimilar is designed to mimic the structure and function of the original antibody, Talacotuzumab, which is used in the treatment of acute myeloid leukemia (AML). In this article, we will discuss the structure, activity, and potential applications of Talacotuzumab Biosimilar.

Structure of Talacotuzumab Biosimilar

Talacotuzumab Biosimilar is a monoclonal antibody that is produced in a laboratory using recombinant DNA technology. It is a humanized IgG1 kappa antibody, meaning that it contains both human and mouse components. The antibody is composed of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains are made up of four constant regions (CH1, CH2, CH3, and CH4) and one variable region (VH), while the light chains consist of two constant regions (CL) and one variable region (VL). The variable regions of the antibody are responsible for binding to the target receptors, NOTCH2 and NOTCH3.

Activity of Talacotuzumab Biosimilar

Talacotuzumab Biosimilar works by binding to the NOTCH2 and NOTCH3 receptors, which are members of the NOTCH family of transmembrane receptors. These receptors are involved in cell signaling pathways that regulate cell growth, differentiation, and survival. In AML, the NOTCH2 and NOTCH3 receptors are overexpressed, leading to uncontrolled cell growth and proliferation. By binding to these receptors, Talacotuzumab Biosimilar inhibits their activity and disrupts the signaling pathways, thereby slowing down the growth of cancer cells.

Applications of Talacotuzumab Biosimilar

Talacotuzumab Biosimilar has potential applications in the treatment of AML and other cancers that overexpress NOTCH2 and NOTCH3 receptors. It can be used as a monotherapy or in combination with other chemotherapeutic agents. In preclinical studies, Talacotuzumab Biosimilar has shown promising results in inhibiting the growth of AML cells and reducing tumor burden. It has also been shown to enhance the anti-tumor activity of other chemotherapy drugs.

In addition to its therapeutic potential, Talacotuzumab Biosimilar can also be used as a research tool to study the role of NOTCH2 and NOTCH3 receptors in cancer. It can be used to investigate the mechanisms of action of these receptors and to identify potential biomarkers for predicting response to therapy.

Clinical Trials of Talacotuzumab Biosimilar

Talacotuzumab Biosimilar is currently being evaluated in clinical trials for the treatment of AML. In a phase I/II study, the safety, tolerability, and efficacy of Talacotuzumab Biosimilar in combination with standard chemotherapy are being investigated in patients with relapsed or refractory AML. Preliminary results from this study have shown promising anti-leukemic activity and manageable safety profile of the biosimilar.

Conclusion

Talacotuzumab Biosimilar is a promising therapeutic agent that targets the NOTCH2 and NOTCH3 receptors, which are overexpressed in AML and other cancers. Its structure, activity, and potential applications make it a valuable tool for both research and treatment. Ongoing clinical trials are expected to provide more evidence on the safety and efficacy of this biosimilar, which has the potential to improve the outcomes of patients with AML.

SDS-PAGE for Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade

SDS-PAGE for Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade in WB Assay

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade in WB Assay

Talacotuzumab Biosimilar - Anti-CD123;IL-3Rα mAb - Research Grade can bind to its target in Western Blot Assay as detected on gel analysis.

Talacotuzumab Biosimilar - Anti-NOTCH2,  NOTCH3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Talacotuzumab Biosimilar – Anti-NOTCH2, NOTCH3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products