Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Talacotuzumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Talacotuzumab ELISA Kit

Talacotuzumab ELISA Kit

Product name Talacotuzumab ELISA Kit
Uniprot ID P26951
Raw Antigen Sequence MVLLWLTLLLIALPCLLQTKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWRTSLLIALGTLLALVCVFVICRRYLVMQRLFPRIPHMKDPIGDSFQNDKLVVWEAGKAGLEECLVTEVQVVQKT
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX214
Note For research use only.
Sample type Plasma, Serum
Target Talacotuzumab
Immunogen Talacotuzumab

Introduction

Talacotuzumab is a novel monoclonal antibody that has shown promising results in the treatment of acute myeloid leukemia (AML). It is a therapeutic target that has gained attention in recent years due to its potential to improve patient outcomes. In order to accurately measure the levels of Talacotuzumab in patient samples, an ELISA (enzyme-linked immunosorbent assay) kit has been developed. In this article, we will explore the structure, activity, and application of the Talacotuzumab ELISA kit.

Structure of Talacotuzumab ELISA Kit

The Talacotuzumab ELISA kit is composed of several components that work together to accurately detect and quantify the levels of Talacotuzumab in a patient sample. The kit contains a microplate coated with a specific antibody that is capable of binding to Talacotuzumab. This antibody is immobilized on the surface of the microplate, allowing for efficient capture of the target molecule.

In addition to the coated microplate, the kit also includes a series of reagents such as wash buffers, enzyme conjugate, and substrate solution. These reagents are essential for the detection process and are carefully selected to ensure optimal performance of the assay.

Activity of Talacotuzumab ELISA Kit

The Talacotuzumab ELISA kit works on the principle of a sandwich immunoassay. This means that the target molecule (Talacotuzumab) is sandwiched between two specific antibodies – one immobilized on the microplate and the other conjugated to an enzyme. The enzyme-conjugated antibody acts as a detection molecule and produces a colorimetric signal when the substrate solution is added.

The level of Talacotuzumab in the patient sample is directly proportional to the intensity of the color produced, allowing for accurate quantification. The kit also includes a standard curve, which is used to determine the concentration of Talacotuzumab in the sample. This ensures precise and reliable results.

Application of Talacotuzumab ELISA Kit

The Talacotuzumab ELISA kit has a wide range of applications in the field of AML research and clinical practice. It is primarily used for the detection and quantification of Talacotuzumab in patient samples, allowing for monitoring of treatment efficacy and disease progression. The kit can also be used in preclinical studies to evaluate the pharmacokinetics and pharmacodynamics of Talacotuzumab.

In addition to its use in AML, the Talacotuzumab ELISA kit can also be utilized in other types of cancer research. As Talacotuzumab is a therapeutic target that is being investigated in various malignancies, this kit can be a valuable tool for measuring its levels in different cancer types.

Conclusion

The Talacotuzumab ELISA kit is an essential tool for accurately measuring the levels of Talacotuzumab in patient samples. Its structure and activity make it a reliable and sensitive method for quantification, while its wide range of applications makes it a valuable asset in AML and other cancer research. As the development of Talacotuzumab continues, the use of this ELISA kit will play a crucial role in advancing our understanding and treatment of AML and other malignancies.

Talacotuzumab ELISA Kit

There are no reviews yet.

Be the first to review “Talacotuzumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products