Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Favezelimab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Favezelimab ELISA Kit

Favezelimab ELISA Kit

Product name Favezelimab ELISA Kit
Uniprot ID P18627
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX204
Note For research use only.
Sample type Plasma, Serum
Target Favezelimab
Immunogen Favezelimab

Introduction

Favezelimab ELISA Kit is a highly sensitive and specific tool for the detection and quantification of Favezelimab, a novel therapeutic antibody targeting a specific protein. This kit is designed for use in research and clinical laboratories to support the development and monitoring of Favezelimab-based therapies. In this article, we will discuss the structure, activity, and application of Favezelimab ELISA Kit in detail.

Structure of Favezelimab

Favezelimab is a monoclonal antibody, meaning it is produced by a single clone of immune cells. It is a fully humanized antibody, meaning it is derived from human genes and has a low risk of immunogenicity. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are connected by disulfide bonds and contain the antigen-binding region, while the light chains are responsible for stabilizing the antibody structure.

Activity of Favezelimab

Favezelimab specifically targets and binds to a protein found on the surface of certain cells, known as the therapeutic target. This protein is involved in a variety of cellular processes, including cell growth, differentiation, and survival. By binding to the therapeutic target, Favezelimab blocks its activity and disrupts these processes, leading to a therapeutic effect.

Mechanism of Action

The binding of Favezelimab to the therapeutic target triggers a cascade of events that ultimately leads to the inhibition of the target protein’s function. This can occur through various mechanisms, such as blocking the interaction of the target protein with other molecules or inducing internalization and degradation of the target protein.

Advantages of Favezelimab

Favezelimab has several advantages over other therapeutic antibodies. As a fully humanized antibody, it has a lower risk of immunogenicity and can be administered repeatedly without causing an immune response. Additionally, Favezelimab has a long half-life, which allows for less frequent dosing and improved patient compliance.

Application of Favezelimab ELISA Kit

Favezelimab ELISA Kit is a valuable tool for the development and monitoring of Favezelimab-based therapies. It can be used to measure the levels of Favezelimab in biological samples, such as serum or plasma, to assess the pharmacokinetics of the antibody. This information is crucial for optimizing dosing regimens and predicting the efficacy of the therapy.

Research Applications

Favezelimab ELISA Kit is also widely used in research laboratories to study the expression and function of the therapeutic target. By measuring the levels of the target protein in different tissues or under different conditions, researchers can gain insights into its role in various diseases and identify potential therapeutic applications of Favezelimab.

Clinical Applications

In clinical settings, Favezelimab ELISA Kit can be used to monitor the levels of Favezelimab in patients receiving Favezelimab-based therapies. This allows for the optimization of dosing regimens and the detection of any potential adverse effects. Additionally, Favezelimab ELISA Kit can be used to diagnose and monitor diseases that are associated with an abnormal expression of the therapeutic target.

Conclusion

In summary, Favezelimab ELISA Kit is a powerful tool for the detection and quantification of Favezelimab, a novel therapeutic antibody targeting a specific protein. Its high sensitivity and specificity make it a valuable tool for both research and clinical applications. With its ability to measure Favezelimab levels and the therapeutic target expression, this kit has the potential to greatly advance the development and monitoring of Favezelimab-based therapies.

Favezelimab ELISA Kit

There are no reviews yet.

Be the first to review “Favezelimab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products