Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Favezelimab Biosimilar – Anti-LAG3 mAb – Research Grade

  • PX-TA1838-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade

Product name Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Species Homo Sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Favezelimab,,LAG3,anti-LAG3
Reference PX-TA1838
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade
Uniprot ID P18627
Species Homo Sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Favezelimab,,LAG3,anti-LAG3
Reference PX-TA1838
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1838-50
Uniprot ID P18627
Species Homo Sapiens
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Favezelimab,,LAG3,anti-LAG3
Reference PX-TA1838
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction

Favezelimab Biosimilar, also known as Anti-LAG3 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for various diseases. It is a biosimilar of the original Favezelimab, which is an antibody that targets the Lymphocyte Activation Gene-3 (LAG3) protein. In this article, we will discuss the structure, activity, and potential applications of Favezelimab Biosimilar in the field of medicine.

Structure of Favezelimab Biosimilar

Favezelimab Biosimilar is a fully humanized IgG4 monoclonal antibody, which means that it is composed of human immunoglobulin G4 molecules. It is a large protein molecule with a molecular weight of approximately 150 kDa. The antibody consists of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region.

The variable region of Favezelimab Biosimilar is responsible for its specificity and ability to bind to the LAG3 protein. It is composed of six complementarity-determining regions (CDRs) that form the antigen-binding site. The constant region, on the other hand, is responsible for the effector functions of the antibody, such as complement activation and antibody-dependent cellular cytotoxicity.

Activity of Favezelimab Biosimilar

Favezelimab Biosimilar specifically targets the LAG3 protein, which is a cell surface receptor that is expressed on various immune cells, including T cells, B cells, and natural killer cells. The binding of Favezelimab Biosimilar to LAG3 inhibits its interaction with its ligands, such as MHC class II molecules and galectin-3, leading to the suppression of immune responses.

The main mechanism of action of Favezelimab Biosimilar is through the blockade of LAG3 signaling, which results in the activation of T cells and other immune cells. This leads to enhanced anti-tumor immune responses and improved immune surveillance against cancer cells. Additionally, Favezelimab Biosimilar has been shown to have anti-inflammatory effects by reducing the production of pro-inflammatory cytokines, such as IL-6 and TNF-α.

Applications of Favezelimab Biosimilar

Favezelimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for the treatment of various diseases. Its main application is in the field of oncology, as LAG3 is known to play a role in tumor immune evasion and suppression. Favezelimab Biosimilar has the potential to be used as a monotherapy or in combination with other anti- cancer treatments, such as chemotherapy and immune checkpoint inhibitors.

Apart from

cancer, Favezelimab Biosimilar has also shown potential in the treatment of autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. By inhibiting LAG3 signaling, it can prevent the overactivation of immune cells and reduce inflammation in these diseases.

Conclusion

In summary, Favezelimab Biosimilar is a promising therapeutic agent that targets the LAG3 protein. Its unique structure and mechanism of action make it a potential treatment for various diseases, especially in the field of oncology. Further clinical studies are needed to fully evaluate its efficacy and safety, but it has the potential to become a valuable addition to the current treatment options for cancer and autoimmune diseases.

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade binds to CD223 Recombinant Protein in ELISA assay

Immobilized CD223 Recombinant Protein (cat. No.PX-P4110) at 0.5µg/mL (100µL/well) can bind Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade (cat. No.PX-TA1838) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 9.284M.

Favezelimab Biosimilar - Anti-LAG3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Favezelimab Biosimilar – Anti-LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products