Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Firastotug Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1948-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $220.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Firastotug Biosimilar - Anti-CD152 mAb - Research Grade

Product name Firastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-14-0
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1948
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Firastotug Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2750031-14-0
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1948
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1948-50
Uniprot ID P16410
Source CAS: 2750031-14-0
Species Human
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1948
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

The Structure of Firastotug Biosimilar – Anti-CD152 mAb

Firastotug Biosimilar – Anti-CD152 mAb is a monoclonal antibody (mAb) that is designed to target the CD152 protein, also known as cytotoxic T-lymphocyte-associated protein 4 (CTLA-4). This protein is expressed on the surface of T-cells and plays a crucial role in regulating the immune response. Firastotug Biosimilar is a biosimilar version of the anti-CD152 mAb, which means that it is highly similar in structure and function to the original antibody.

The structure of Firastotug Biosimilar – Anti-CD152 mAb is based on the human IgG1 antibody isotype. It consists of two heavy chains and two light chains that are connected by disulfide bonds. The heavy chains contain four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain two constant domains (CL) and one variable domain (VL). The variable domains are responsible for binding to the CD152 protein, while the constant domains provide stability and effector functions.

The Activity of Firastotug Biosimilar – Anti-CD152 mAb

Firastotug Biosimilar – Anti-CD152 mAb works by binding to the CD152 protein on the surface of T-cells. This binding prevents the interaction of CD152 with its ligands, CD80 and CD86, which are present on antigen-presenting cells. This interaction is crucial for the activation of T-cells and the initiation of an immune response. By blocking this interaction, Firastotug Biosimilar – Anti-CD152 mAb inhibits the activation of T-cells and suppresses the immune response.

In addition to its inhibitory effects on T-cell activation, Firastotug Biosimilar – Anti-CD152 mAb also has other effector functions. It can activate the complement system, leading to the destruction of target cells. It can also bind to Fc receptors on immune cells, such as natural killer cells and macrophages, and induce antibody-dependent cellular cytotoxicity (ADCC) and antibody-dependent cellular phagocytosis (ADCP).

The Application of Firastotug Biosimilar – Anti-CD152 mAb

Firastotug Biosimilar – Anti-CD152 mAb has been extensively studied for its potential therapeutic applications in various diseases. The most well-known and successful application of anti-CD152 mAb is in the treatment of cancer. By inhibiting T-cell activation, Firastotug Biosimilar – Anti-CD152 mAb can prevent the immune system from attacking cancer cells, which often have mechanisms to evade immune surveillance. This makes it an effective immunotherapy for various types of cancer, including melanoma, lung cancer, and renal cell carcinoma.

In addition to cancer, Firastotug Biosimilar – Anti-CD152 mAb has also shown promise in the treatment of autoimmune diseases. By suppressing the immune response, it can reduce the symptoms and progression of diseases such as rheumatoid arthritis, multiple sclerosis, and inflammatory bowel disease.

Firastotug Biosimilar – Anti-CD152 mAb is also being studied for its potential use in organ transplantation. By inhibiting the immune response, it can prevent the rejection of transplanted organs and improve the success rate of transplantation procedures.

Conclusion

In summary, Firastotug Biosimilar – Anti-CD152 mAb is a monoclonal antibody that targets the CD152 protein on the surface of T-cells. It works by inhibiting T-cell activation and has additional effector functions, making it a promising therapeutic agent for cancer, autoimmune diseases, and organ transplantation. Its structure, activity, and applications make it a valuable addition to the field of immunotherapy and hold great potential for improving patient outcomes.

SDS-PAGE for Research Grade Firastotug

SDS-PAGE for Research Grade Firastotug

Research Grade Firastotug, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Research Grade Firastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Firastotug binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Firastotug in indirect ELISA with Goat secondary antibody measured by OD450.

Firastotug Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Firastotug Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products