Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade

  • PX-TA1949-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade

Product name Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2226344-78-9
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1949
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade
Uniprot ID P16410
Source CAS: 2226344-78-9
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1949
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1949-50
Uniprot ID P16410
Source CAS: 2226344-78-9
Species Human
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Buffer 0.01M PBS, pH 7.4
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms anti-CD152, Cytotoxic T-lymphocyte protein 4, CTLA-4, CTLA4, Cytotoxic T-lymphocyte-associated antigen 4
Reference PX-TA1949
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is a novel therapeutic antibody that targets the CD152 protein. This biosimilar is designed to mimic the structure and function of the original Gotistobart antibody, but at a more affordable price for research purposes. In this article, we will explore the structure, activity, and potential applications of this biosimilar.

Structure

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is a monoclonal antibody, meaning it is produced from a single type of immune cell. It is composed of two identical heavy chains and two identical light chains, connected by disulfide bonds. The heavy chains contain the constant regions, while the light chains contain the variable regions that bind to the target protein.

The variable regions of the antibody are designed to specifically bind to the CD152 protein, which is a cell surface receptor found on T cells. This binding is crucial for the activity of the antibody, as it allows it to block the function of CD152 and modulate the immune response.

Activity

The main activity of Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is its ability to block the function of CD152. CD152, also known as CTLA-4, is a negative regulator of T cell activation. When bound by Gotistobart Biosimilar, CD152 is unable to interact with its ligands, which are necessary for its inhibitory function. This results in increased T cell activation and a more robust immune response.

In addition to blocking CD152, this biosimilar also has the potential to induce antibody-dependent cell-mediated cytotoxicity (ADCC). This is a mechanism in which the antibody binds to target cells, such as cancer cells, and activates immune cells to kill them. This activity could have potential therapeutic applications in treating cancers that overexpress CD152.

Applications

Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade has a wide range of potential applications in both basic and clinical research. Its ability to modulate the immune response makes it a valuable tool for studying various diseases and disorders related to immune dysfunction.

One potential application of this biosimilar is in the treatment of autoimmune diseases. By blocking CD152, it could potentially reduce the inhibitory signals that lead to autoimmune reactions. This could be particularly beneficial in diseases such as rheumatoid arthritis and multiple sclerosis.

Another potential application is in cancer research. As mentioned earlier, this biosimilar has the ability to induce ADCC, making it a potential candidate for cancer immunotherapy. By targeting CD152, it could potentially enhance the immune response against cancer cells and improve treatment outcomes.

Conclusion

In conclusion, Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade is a promising therapeutic antibody with a unique mechanism of action. Its structure, activity, and potential applications make it a valuable tool for research in various fields, including immunology, oncology, and autoimmune diseases. With its affordable price and similar efficacy to the original Gotistobart antibody, this biosimilar has the potential to advance scientific discoveries and improve patient outcomes.

Research Grade Gotistobart binds to Mouse CD152 recombinant protein in ELISA Assay

Research Grade Gotistobart binds to Mouse CD152 recombinant protein in ELISA Assay

Mouse CD152 recombinant protein(cat. No.PX-P6405) at 0.5µg/mL (100µL/well) can bind Research Grade Gotistobart in indirect ELISA with Goat secondary antibody measured by OD450.

Gotistobart Biosimilar - Anti-CD152 mAb - Research Grade

There are no reviews yet.

Be the first to review “Gotistobart Biosimilar – Anti-CD152 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products