Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Onacrisantaspase Biosimilar – Anti-L-asparagine amidohydrolase mAb – Research Grade

Uniprot ID:
L-asparagine amidohydrolase

Original price was: $203.00.Current price is: $167.00.

50ug 18% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade

Product name PX-TA2157-50
Uniprot ID L-asparagine amidohydrolase
Source CAS: 2256099-52-0
Expression system XtenCHO
Raw Antigen Sequence MQCEEAHVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLPPLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMKNKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIAVKSRNKQLVHYLLDRDADPYKIDDFNLTPLRHAKKLNLQDLVIRMKKMKKVQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2157
Note For research use only. Not suitable for human use.
Isotype Dickeya dadantii L-asparaginase fused at its N-terminus to a hydrophobic random coil proline-alanine-rich peptide.
Product name Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade
Uniprot ID L-asparagine amidohydrolase
Source CAS: 2256099-52-0
Expression system XtenCHO
Raw Antigen Sequence MQCEEAHVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLPPLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMKNKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIAVKSRNKQLVHYLLDRDADPYKIDDFNLTPLRHAKKLNLQDLVIRMKKMKKVQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2157
Note For research use only. Not suitable for human use.
Isotype Dickeya dadantii L-asparaginase fused at its N-terminus to a hydrophobic random coil proline-alanine-rich peptide.
Product name Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade
Uniprot ID L-asparagine amidohydrolase
Source CAS: 2256099-52-0
Expression system XtenCHO
Raw Antigen Sequence MQCEEAHVLVLYTGGTIGMKYIDGVYQPEANYLLHAIRDLSLLNDDDYVSTYYSDAEIRPYCLPPLQHSKKRVVYWMIEYDPLLDSSDMTFDDWIHIGKDIQRAYDQYVGFVILHGTDTLAYTACALSFMLENVRKPIVITGAQIPVCEVRSDGRENLIGALIIAANYDIPEVTVYFNNKLFRGNRTVKIDNRSMDAFESPNMLPIAYMDVDIKVNYDSIFRSPSMAPFVVHDQLCRNVGLLRIFPSMSIENVRASLQAPIEGVVLQTFGAGNMPSHRTDIIDELKKAVDRGCIIINCSQCVRGQVDIHYLTGKVLYDMGIIPGSDMTAEAALTKLSYVLSKDCWELVEKKAMMVKNIRGELTVAKAEPLKDLEIVSQMARFLHLSSSHEMKLLCHAIFPQLLCYAASNGDIEMLKALHENGVDLSVVDYNGRNALHVAASAGHVGAVKYLLTQGVSFHLRDQWDENALVSAVKMKNKILIETLRSAGALLSINSRRLGVELCLCASYGDTETLNSWLAAGADINQQDYNGETALHIAVKSRNKQLVHYLLDRDADPYKIDDFNLTPLRHAKKLNLQDLVIRMKKMKKVQ
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2157
Note For research use only. Not suitable for human use.
Isotype Dickeya dadantii L-asparaginase fused at its N-terminus to a hydrophobic random coil proline-alanine-rich peptide.

The Structure of Onacrisantaspase Biosimilar

Onacrisantaspase Biosimilar is a monoclonal antibody (mAb) that has been developed as a biosimilar to the therapeutic antibody, Onivyde (irinotecan liposome injection). The structure of Onacrisantaspase Biosimilar is similar to that of Onivyde, as it is also a humanized IgG1 kappa monoclonal antibody. This means that it is composed of two heavy chains and two light chains, with a molecular weight of approximately 150 kDa.

The heavy chains of Onacrisantaspase Biosimilar consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH). The light chains, on the other hand, have two constant domains (CL and CL1) and one variable domain (VL). These variable domains are responsible for the specificity of the antibody, as they bind to a specific target molecule.

The Activity of Onacrisantaspase Biosimilar

Onacrisantaspase Biosimilar is a biosimilar of Onivyde, which is a liposomal formulation of irinotecan. Irinotecan is an anticancer drug that works by inhibiting the enzyme topoisomerase I, which is involved in DNA replication and repair. By inhibiting this enzyme, irinotecan prevents cancer cells from dividing and growing, ultimately leading to their death.

Onacrisantaspase Biosimilar, being a monoclonal antibody, works in a different way. It specifically targets and binds to the enzyme L-asparagine amidohydrolase, also known as asparaginase. This enzyme is responsible for breaking down the amino acid asparagine, which is essential for the growth and survival of cancer cells. By binding to and inhibiting asparaginase, Onacrisantaspase Biosimilar deprives cancer cells of the asparagine they need to grow and survive, ultimately leading to their death.

The Application of Onacrisantaspase Biosimilar

Onacrisantaspase Biosimilar is primarily used as a treatment for acute lymphoblastic leukemia (ALL), a type of blood cancer that affects the white blood cells. It is specifically indicated for use in patients who have developed hypersensitivity to the asparaginase contained in other chemotherapy regimens.

In addition to ALL, Onacrisantaspase Biosimilar has also shown promising results in the treatment of other types of cancer, such as acute myeloid leukemia (AML) and non-Hodgkin’s lymphoma. It is currently being investigated in clinical trials for these indications.

The Role of Onacrisantaspase Biosimilar as a Therapeutic Antibody

Onacrisantaspase Biosimilar is a prime example of a therapeutic antibody, which is a type of antibody that is specifically designed and used for therapeutic purposes. Unlike traditional antibodies, which are produced naturally by the immune system to fight off infections, therapeutic antibodies are engineered in a laboratory to target and bind to specific molecules involved in diseases.

In the case of Onacrisantaspase Biosimilar, it is designed to target and inhibit the activity of the asparaginase enzyme, which is essential for the growth and survival of cancer cells. By doing so, it effectively kills cancer cells and helps to slow down the progression of the disease.

The Future of Onacrisantaspase Biosimilar

Onacrisantaspase Biosimilar has shown promising results in clinical trials and has been approved for use in the treatment of ALL. As more research is conducted, it is expected that this biosimilar will also be approved for other types of cancer, providing patients with more treatment options.

In addition, the development of biosimilars like Onacrisantaspase Biosimilar is an important step in making cancer treatments more affordable and accessible. By providing a more cost-effective alternative to the original therapeutic antibody, more patients will be able to access life-saving treatments.

In

Onacrisantaspase Biosimilar - Anti-L-asparagine amidohydrolase mAb - Research Grade

There are no reviews yet.

Be the first to review “Onacrisantaspase Biosimilar – Anti-L-asparagine amidohydrolase mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products