Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Inbakicept Biosimilar – Anti-IL15 fusion protein – Research Grade

Uniprot ID:
P40933

Original price was: $305.00.Current price is: $250.00.

50ug 18% OFF + 250 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade

Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2015-50
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)
Product name Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade
Uniprot ID P40933
Expression system XtenCHO
Raw Antigen Sequence MRISKPHLRSISIQCYLCLLLNSHFLTEAGIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-IL15, IL-15, Interleukin-15
Reference PX-TA2015
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [IL15RA (interleukin 15 receptor subunit alpha, CD215, IL-15RA)]2 - IGHG1 Fc (Fragment constant)

Introduction

Inbakicept Biosimilar, also known as Anti-IL15 fusion protein, is a novel therapeutic agent that has shown promising results in the treatment of various inflammatory and autoimmune diseases. This biosimilar is a fusion protein composed of a monoclonal antibody and the interleukin-15 (IL15) receptor alpha chain, which has been designed to specifically target and neutralize IL15, a key cytokine involved in the pathogenesis of several diseases. In this scientific web content, we will provide a detailed description of the structure, activity, and potential applications of Inbakicept Biosimilar in the field of medicine.

Structure

Inbakicept Biosimilar is a fusion protein that consists of two main components – a monoclonal antibody and the IL15 receptor alpha chain. The monoclonal antibody is derived from a specific cell line and is designed to bind to IL15 with high affinity and specificity. The IL15 receptor alpha chain is a protein that is naturally found on the surface of immune cells and is responsible for transmitting signals from IL15. The fusion of these two components creates a potent molecule that can effectively block the activity of IL15.

Activity

IL15 is a pro-inflammatory cytokine that plays a crucial role in the immune response. It is involved in the activation and proliferation of T cells, B cells, and natural killer cells, as well as the production of other inflammatory mediators. However, excessive or dysregulated IL15 activity has been linked to the development of various autoimmune and inflammatory diseases, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease. Inbakicept Biosimilar works by binding to IL15 and blocking its interaction with the IL15 receptor alpha chain, thereby inhibiting its activity. This leads to a reduction in the production of pro-inflammatory cytokines and the suppression of immune cell activation, resulting in the alleviation of symptoms associated with these diseases.

Application

Inbakicept Biosimilar has shown promising results in preclinical and clinical studies, making it a potential therapeutic option for various inflammatory and autoimmune diseases. Its ability to specifically target and neutralize IL15 makes it a more targeted and potentially safer alternative to traditional immunosuppressive therapies. Inbakicept Biosimilar is currently being investigated for the treatment of rheumatoid arthritis, psoriasis, and inflammatory bowel disease, with promising results in reducing disease activity and improving symptoms. Additionally, this biosimilar has also shown potential in the treatment of certain types of cancer, as IL15 has been implicated in tumor growth and progression.

Conclusion

Inbakicept Biosimilar, also known as Anti-IL15 fusion protein, is a novel therapeutic agent that has shown promising results in the treatment of various inflammatory and autoimmune diseases. Its unique structure and mechanism of action make it a potential alternative to traditional immunosuppressive therapies. With ongoing research and clinical trials, Inbakicept Biosimilar has the potential to provide effective and targeted treatment options for patients suffering from a range of diseases.

SDS-PAGE for Research Grade Inbakicept

SDS-PAGE for Research Grade Inbakicept

Research Grade Inbakicept, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Inbakicept Biosimilar - Anti-IL15 fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Inbakicept Biosimilar – Anti-IL15 fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products