Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Opinercept Biosimilar – Anti-TNF fusion protein – Research Grade

Uniprot ID:
P01375

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade

Product name Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2020
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)
Product name Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2020
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2020-50
Uniprot ID P01375
Expression system XtenCHO
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-TNF, Tumor necrosis factor ligand superfamily member 2, N-terminal fragment, ICD2, NTF, TNF-a, TNF-alpha, Tumor necrosis factor, TNFSF2, TNFA, Cachectin, ICD1
Reference PX-TA2020
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [TNFRSF1B (tumor necrosis factor receptor (TNFR) superfamily member 1B, TNFBR, p75, CD120b)]2 - IGHG1 Fc (Fragment constant)

Introduction

Opinercept Biosimilar is a novel anti-TNF fusion protein that has been developed as a potential therapeutic agent for various inflammatory diseases. This biosimilar is a recombinant protein that mimics the structure and function of the human TNF receptor, and has shown promising results in pre-clinical studies. In this article, we will discuss the structure, activity, and potential applications of Opinercept Biosimilar as a research grade antibody and therapeutic target.

Structure of Opinercept Biosimilar

Opinercept Biosimilar is a fusion protein consisting of two components – the extracellular domain of the human TNF receptor and the Fc region of human IgG1 antibody. The extracellular domain of the TNF receptor is responsible for binding to TNF, while the Fc region of the antibody provides stability and enhances the half-life of the protein. This fusion protein is produced using recombinant DNA technology, which ensures a consistent and high-quality product.

Activity of Opinercept Biosimilar

Opinercept Biosimilar acts as a competitive inhibitor of TNF, a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various inflammatory diseases. By binding to TNF, Opinercept Biosimilar prevents it from interacting with its receptors on the cell surface, thereby inhibiting the downstream signaling pathways that lead to inflammation. This activity of Opinercept Biosimilar makes it a potential therapeutic agent for a wide range of inflammatory conditions, including rheumatoid arthritis, psoriasis, and inflammatory bowel disease.

Application of Opinercept Biosimilar

As a research grade antibody, Opinercept Biosimilar can be used in various laboratory experiments to study the role of TNF in different disease models. Its ability to specifically bind to TNF makes it a valuable tool for researchers to investigate the mechanisms of TNF-mediated inflammation and develop new treatments for inflammatory diseases.

In addition to its research applications, Opinercept Biosimilar also has potential as a therapeutic agent. In pre-clinical studies, it has shown promising results in reducing disease severity in animal models of rheumatoid arthritis and psoriasis. Furthermore, its safety and efficacy have been demonstrated in phase I clinical trials, making it a promising candidate for future clinical development.

Advantages of Opinercept Biosimilar

Opinercept Biosimilar offers several advantages over existing anti-TNF therapies. As a biosimilar, it is highly similar to the reference product and has comparable efficacy and safety profiles. However, its production using recombinant DNA technology allows for a more consistent and cost-effective manufacturing process. Additionally, its fusion protein structure provides a longer half-life compared to other biologics, reducing the frequency of dosing and potentially improving patient compliance.

Conclusion

In summary, Opinercept Biosimilar is a novel anti-TNF fusion protein with a unique structure and promising activity against TNF-mediated inflammation. As a research grade antibody, it has the potential to advance our understanding of inflammatory diseases and serve as a valuable tool for drug discovery. Furthermore, its potential as a therapeutic agent makes it a promising candidate for the treatment of various inflammatory conditions. With ongoing clinical development, Opinercept Biosimilar has the potential to improve the lives of patients suffering from chronic inflammatory diseases.

Opinercept Biosimilar - Anti-TNF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Opinercept Biosimilar – Anti-TNF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products