Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Eflimrufusp Alfa Biosimilar – Anti-VEGF fusion protein – Research Grade

Uniprot ID:
P09038 & P15692

Original price was: $233.00.Current price is: $167.00.

50ug 28% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade

Product name Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade
Uniprot ID P09038 & P15692
Expression system XtenCHO
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-VEGF
Reference PX-TA2013
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) domain 2 fragment (132-232) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309) domain 3 fragment (227-327) - FGFR1 (fibroblast growth factor receptor 1, FLT2, KAL2) domains 2 and 3 fragment (150-361)]2 - IGHG1 Fc (Fragment constant)
Product name Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade
Uniprot ID P09038 & P15692
Expression system XtenCHO
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-VEGF
Reference PX-TA2013
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) domain 2 fragment (132-232) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309) domain 3 fragment (227-327) - FGFR1 (fibroblast growth factor receptor 1, FLT2, KAL2) domains 2 and 3 fragment (150-361)]2 - IGHG1 Fc (Fragment constant)
Product name PX-TA2013-50
Uniprot ID P09038 & P15692
Expression system XtenCHO
Raw Antigen Sequence MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-VEGF
Reference PX-TA2013
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Fusion - [FLT1 (fms-related tyrosine kinase 1, vascular endothelial growth factor receptor 1, VEGFR-1, VEGFR, FLT, FRT, vascular permeability factor receptor) domain 2 fragment (132-232) - KDR (kinase insert domain receptor, vascular endothelial growth factor receptor 2, VEGFR2, VEGF-R2, FLK1, CD309) domain 3 fragment (227-327) - FGFR1 (fibroblast growth factor receptor 1, FLT2, KAL2) domains 2 and 3 fragment (150-361)]2 - IGHG1 Fc (Fragment constant)

Introduction to Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar, also known as Anti-VEGF fusion protein, is a novel therapeutic antibody that has been developed as a biosimilar to the original Eflimrufusp Alfa. This biosimilar has been designed to mimic the structure and function of the original antibody, providing a more affordable and accessible treatment option for patients.

Structure of Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar is a fusion protein that is composed of two different components – an antibody and a therapeutic target. The antibody component is a monoclonal antibody that specifically targets and binds to vascular endothelial growth factor (VEGF), a protein that plays a crucial role in the formation of new blood vessels. The therapeutic target component is a modified version of the original Eflimrufusp Alfa, which has been genetically engineered to enhance its therapeutic properties.

The antibody component of Eflimrufusp Alfa Biosimilar is made up of two heavy chains and two light chains, which are connected by disulfide bonds. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains consist of two constant domains (CL) and one variable domain (VL). The variable domains are responsible for the specificity of the antibody, as they contain the antigen-binding site that recognizes and binds to VEGF.

The therapeutic target component of Eflimrufusp Alfa Biosimilar is a fusion protein that consists of the extracellular domain of VEGF receptor 1 (VEGFR1) and the Fc region of human immunoglobulin G1 (IgG1). This fusion protein acts as a decoy receptor, binding to VEGF and preventing it from binding to its natural receptors on the surface of endothelial cells. This effectively blocks the signaling pathway that promotes the formation of new blood vessels, which is important in the treatment of diseases such as cancer and age-related macular degeneration.

Activity of Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar works by inhibiting the activity of VEGF, which is a key factor in the development and progression of various diseases. VEGF is a potent stimulator of angiogenesis, the process by which new blood vessels are formed from existing ones. In diseases such as cancer, VEGF promotes the growth of new blood vessels that supply nutrients and oxygen to the tumor, allowing it to grow and spread. In age-related macular degeneration, VEGF causes abnormal blood vessel growth in the retina, leading to vision loss.

By binding to VEGF and preventing it from binding to its natural receptors, Eflimrufusp Alfa Biosimilar blocks the signaling pathway that promotes angiogenesis. This helps to inhibit the growth and spread of tumors in cancer patients, and also prevents the abnormal blood vessel growth in the retina of patients with age-related macular degeneration.

Application of Eflimrufusp Alfa Biosimilar

Eflimrufusp Alfa Biosimilar has been approved for the treatment of various diseases, including metastatic colorectal cancer, non-small cell lung cancer, and age-related macular degeneration. It is administered through intravenous infusion and is typically used in combination with other standard treatments for these diseases.

As a biosimilar, Eflimrufusp Alfa Biosimilar provides a more affordable and accessible treatment option for patients, as it is typically priced lower than the original Eflimrufusp Alfa. It also has the potential to increase patient access to this important therapeutic antibody, as it can be manufactured and distributed more widely.

Conclusion Eflimrufusp Alfa Biosimilar, also

Eflimrufusp Alfa Biosimilar - Anti-VEGF fusion protein - Research Grade

There are no reviews yet.

Be the first to review “Eflimrufusp Alfa Biosimilar – Anti-VEGF fusion protein – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products