Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Efpegerglucagon Biosimilar – Anti-GLP-1(7-36) mAb – Research Grade

Uniprot ID:
P01275

Original price was: $226.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade

Product name PX-TA2156-50
Uniprot ID P01275
Source CAS: 2766774-81-4
Expression system XtenCHO
Raw Antigen Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2156
Note For research use only. Not suitable for human use.
Isotype Synthetic glucagon peptide analogue conjugated with human IgG4 Fc fragment
Product name Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade
Uniprot ID P01275
Source CAS: 2766774-81-4
Expression system XtenCHO
Raw Antigen Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2156
Note For research use only. Not suitable for human use.
Isotype Synthetic glucagon peptide analogue conjugated with human IgG4 Fc fragment
Product name Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade
Uniprot ID P01275
Source CAS: 2766774-81-4
Expression system XtenCHO
Raw Antigen Sequence MKSIYFVAGLFVMLVQGSWQRSLQDTEEKSRSFSASQADPLSDPDQMNEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIVEELGRRHADGSFSDEMNTILDNLAARDFINWLIQTKITDRK
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2156
Note For research use only. Not suitable for human use.
Isotype Synthetic glucagon peptide analogue conjugated with human IgG4 Fc fragment

Introduction

Efpegerglucagon Biosimilar is a research grade therapeutic antibody that targets glucagon-like peptide-1 (GLP-1), a hormone that plays a crucial role in regulating blood sugar levels. This biosimilar is a monoclonal antibody (mAb) that is designed to mimic the activity of GLP-1 and has potential applications in the treatment of diabetes and other metabolic disorders. In this article, we will explore the structure, activity, and potential applications of Efpegerglucagon Biosimilar in detail.

Structure of Efpegerglucagon Biosimilar

Efpegerglucagon Biosimilar is a recombinant, fully humanized monoclonal antibody that is produced using advanced biotechnology techniques. It is composed of two heavy chains and two light chains, each containing a variable region and a constant region. The variable region is responsible for binding to the target molecule, GLP-1, while the constant region provides stability and effector functions.

Activity of Efpegerglucagon Biosimilar

Efpegerglucagon Biosimilar binds specifically to GLP-1 with high affinity, thereby inhibiting its degradation and prolonging its activity in the body. GLP-1 is a hormone produced by the intestinal cells in response to food intake and plays a crucial role in glucose homeostasis. It stimulates insulin secretion, inhibits glucagon release, and slows down gastric emptying, all of which contribute to lowering blood sugar levels. By mimicking the activity of GLP-1, Efpegerglucagon Biosimilar has the potential to regulate blood sugar levels and improve insulin sensitivity.

Applications of Efpegerglucagon Biosimilar

1. Treatment of Diabetes Efpegerglucagon Biosimilar has potential applications in the treatment of both type 1 and type 2 diabetes. In type 1 diabetes, the body is unable to produce insulin, and in type 2 diabetes, the body becomes resistant to the effects of insulin. By mimicking the activity of GLP-1, Efpegerglucagon Biosimilar can stimulate insulin secretion and improve insulin sensitivity, thereby helping to control blood sugar levels in both types of diabetes.

2. Management of Obesity Obesity is a major risk factor for developing type 2 diabetes. GLP-1 has been shown to play a role in appetite regulation and weight loss. By binding to GLP-1 and prolonging its activity, Efpegerglucagon Biosimilar can potentially aid in weight loss and management of obesity.

3. Treatment of Non-Alcoholic Fatty Liver Disease (NAFLD) NAFLD is a condition characterized by the accumulation of fat in the liver, which can lead to liver damage and other metabolic complications. GLP-1 has been shown to have a protective effect on the liver by reducing fat accumulation and inflammation. Efpegerglucagon Biosimilar, by mimicking the activity of GLP-1, has the potential to be used in the treatment of NAFLD.

4. Cardiovascular Diseases Diabetes and obesity are major risk factors for developing cardiovascular diseases. GLP-1 has been shown to have cardioprotective effects by reducing blood pressure and improving heart function. Efpegerglucagon Biosimilar, by mimicking the activity of GLP-1, has the potential to be used in the prevention and treatment of cardiovascular diseases.

Conclusion

In conclusion, Efpegerglucagon Biosimilar is a research grade monoclonal antibody that targets GLP-1 and has potential applications in the treatment of diabetes, obesity, NAFLD, and cardiovascular diseases. Its structure and activity make it a promising candidate for therapeutic use, and further research and clinical trials are needed to fully explore its potential in the field of metabolic disorders.

Efpegerglucagon Biosimilar - Anti-GLP-1(7-36) mAb - Research Grade

There are no reviews yet.

Be the first to review “Efpegerglucagon Biosimilar – Anti-GLP-1(7-36) mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products