Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CSF1 / M-CSF (in Mammalian), N-His, recombinant protein

  • PX-P5665
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P09603
Molecular weight:
29.36 kDa

$500.00

100ug + 500 loyalty points
His Glu33–Arg255
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CSF1 / M-CSF (in Mammalian), N-His, recombinant protein

Product name CSF1 / M-CSF (in Mammalian), N-His, recombinant protein
Uniprot ID P09603
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSSQDVVTKPDCNCLYPKAIPSSDPASVSPHQPLAPSMAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPR
Molecular weight 29.36 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Glu33-Arg255
Protein Accession P09603
Reference PX-P5665
Note For research use only
Molecular Constructor
His Glu33–Arg255

Lacnotuzumab Biosimilar - Anti-CSF1, MCSF mAb binds to CSF1 / M-CSF (in Mammalian), N-His, recombinant protein in indirect ELISA Assay

Lacnotuzumab Biosimilar - Anti-CSF1, MCSF mAb binds to CSF1 / M-CSF (in Mammalian), N-His, recombinant protein in indirect ELISA Assay

Immobilized CSF1 / M-CSF (in Mammalian), N-His, recombinant protein (cat. No.PX-P5665) at 0.5µg/mL (100µL/well) can bind to Lacnotuzumab Biosimilar - Anti-CSF1, MCSF mAb (cat. No.PX-TA1466) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

CSF1 / M-CSF (in Mammalian), N-His, recombinant protein

There are no reviews yet.

Be the first to review “CSF1 / M-CSF (in Mammalian), N-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products