Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Growth/differentiation factor 11(GDF11)

Host species:
Escherichia coli (E.coli)
Uniprot ID:
O95390
Molecular weight:
13.7kDa

$217.00

50ug + 217 loyalty points
His Asn299–Ser407
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Growth/differentiation factor 11(GDF11)

Product name Growth/differentiation factor 11(GDF11)
Uniprot ID O95390
Uniprot link https://www.uniprot.org/uniprot/O95390
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAG PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Molecular weight 13.7kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn299-Ser407
Protein Accession O95390
Spec:Entrez GeneID 10220
Spec:NCBI Gene Aliases VHO; BMP11; BMP-11
NCBI Reference O95390
Aliases /Synonyms Bone morphogenetic protein 11,Bone morphogenetic protein 11,BMP-11,BMP11
Reference PX-P4823
Note For research use only
Molecular Constructor
His Asn299–Ser407
Product name Growth/differentiation factor 11(GDF11)
Uniprot ID O95390
Uniprot link https://www.uniprot.org/uniprot/O95390
Expression system Prokaryotic expression
Raw Antigen Sequence MGSHHHHHHSGNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAG PCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Molecular weight 13.7kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >70% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Asn299-Ser407
Protein Accession O95390
Spec:Entrez GeneID 10220
Spec:NCBI Gene Aliases VHO; BMP11; BMP-11
NCBI Reference O95390
Aliases /Synonyms Bone morphogenetic protein 11,Bone morphogenetic protein 11,BMP-11,BMP11
Reference PX-P4823
Note For research use only
Molecular Constructor
His Asn299–Ser407

There are no reviews yet.

Be the first to review “Growth/differentiation factor 11(GDF11)”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products