Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Cow PAG1B Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Cow
Uniprot ID:
Q29432
Molecular weight:
45,67 kDa

$250.00

50ug + 250 loyalty points
Full-length
size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Cow PAG1B Recombinant Protein

Product name Cow PAG1B Recombinant Protein
Uniprot ID Q29432
Uniprot link http://www.uniprot.org/uniprot/Q29432
Origin species Cow
Expression system Prokaryotic expression
Raw Antigen Sequence MGHHHHHHHHHHSSGHIEGRHMLEMKWLVLLGLVAFSECIVKIPLRRLKTMRNVVSGKNMLNNFLKEHAYSLSQISFRGS NLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGR MKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDERE GSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRG SEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGL ARAV
Molecular weight 45,67 kDa
Purity estimated 80%
Buffer NaH2PO4 75mM, NaCl 150mM, Urea 6M, pH 6-8.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_776836.1
Spec:Entrez GeneID 281964
Spec:NCBI Gene Aliases PAG1B
Spec:SwissProtID Q29432
NCBI Reference NP_776836.1
Aliases /Synonyms PAG1B, pregnancy-associated glycoprotein 1 precursor, PAG 1, Pregnancy-specific protein B, PSP-B
Reference PX-P1136
Note For research use only
Molecular Constructor
Full-length
Product name Cow PAG1B Recombinant Protein
Uniprot ID Q29432
Uniprot link http://www.uniprot.org/uniprot/Q29432
Origin species Cow
Expression system Prokaryotic expression
Raw Antigen Sequence MGHHHHHHHHHHSSGHIEGRHMLEMKWLVLLGLVAFSECIVKIPLRRLKTMRNVVSGKNMLNNFLKEHAYSLSQISFRGS NLTTHPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSSTFRLTNKTFRITYGSGR MKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNYPNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDERE GSVVMFGGVDHRYYEGELNWVPLIQAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRG SEHYVPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFLRLYFSVFDRGNDRIGL ARAV
Molecular weight 45,67 kDa
Purity estimated 80%
Buffer NaH2PO4 75mM, NaCl 150mM, Urea 6M, pH 6-8.
Form liquid
Delivery condition Dry Ice
Delivery lead time in business days 10-25
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Full-length
Protein Accession NP_776836.1
Spec:Entrez GeneID 281964
Spec:NCBI Gene Aliases PAG1B
Spec:SwissProtID Q29432
NCBI Reference NP_776836.1
Aliases /Synonyms PAG1B, pregnancy-associated glycoprotein 1 precursor, PAG 1, Pregnancy-specific protein B, PSP-B
Reference PX-P1136
Note For research use only
Molecular Constructor
Full-length

General information onCow PAG1B Recombinant Protein

Pregnancy associated glycoproteins (PAGs) are widely glycosylated secretory proteins of ruminant trophoblast cells. Bovine pregnancy-associated glycoprotein-1 (PAG-1) may play an important role during pregnancy and is defined as a potential biochemical marker of pregnancy in ungulates.

  • Szenci O, Karen A, Bajcsy AC, Gáspárdy A, de Sousa NM, Beckers JF. Effect of restraint stress on plasma concentrations of cortisol, progesterone and pregnancy associated-glycoprotein-1 in pregnant heifers during late embryonic development. Theriogenology. 2011 Nov;76(8):1380-5. doi: 10.1016/j.theriogenology.2011.05.030. Epub 2011 Aug 26. PubMed PMID: 21872319.
  • Xie S, Green J, Beckers JF, Roberts RM. The gene encoding bovine pregnancy-associated glycoprotein-1, an inactive member of the aspartic proteinase family. Gene. 1995 Jul 4;159(2):193-7. PubMed PMID: 7622048.
  • Mur-Novales R, López-Gatius F, Serrano-Pérez B, García-Ispierto I, Darwich L, Cabezón O, de Sousa NM, Beckers JF, Almería S. Experimental Neospora Caninum Infection in Pregnant Dairy Heifers Raises Concentrations of Pregnancy-Associated Glycoproteins 1 and 2 in Foetal Fluids. Reprod Domest Anim. 2016 Apr;51(2):282-6. doi: 10.1111/rda.12678. Epub 2016 Mar 3. PubMed PMID: 26936628.
  • Serrano-Pérez B, Hansen PJ, Mur-Novales R, García-Ispierto I, de Sousa NM, Beckers JF, Almería S, López-Gatius F. Crosstalk between uterine serpin (SERPINA14) and pregnancy-associated glycoproteins at the fetal-maternal interface in pregnant dairy heifers experimentally infected with Neospora caninum. Theriogenology. 2016 Aug;86(3):824-30. doi: 10.1016/j.theriogenology.2016.03.003. Epub 2016 Mar 11. PubMed PMID: 27045629.
  • Serrano-Pérez B, Garcia-Ispierto I, de Sousa NM, Beckers JF, Almería S, López-Gatius F. Gamma interferon production and plasma concentrations of pregnancy-associated glycoproteins 1 and 2 in gestating dairy cows naturally infected with Neospora caninum. Reprod Domest Anim. 2014 Apr;49(2):275-80. doi: 10.1111/rda.12267. Epub 2014 Jan 23. PubMed PMID: 24456132.
  • Xie SC, Low BG, Nagel RJ, Kramer KK, Anthony RV, Zoli AP, Beckers JF, Roberts RM. Identification of the major pregnancy-specific antigens of cattle and sheep as inactive members of the aspartic proteinase family. Proc Natl Acad Sci U S A. 1991 Nov 15;88(22):10247-51. PubMed PMID: 1946444; PubMed Central PMCID: PMC52905.
  • Ishiwata H, Katsuma S, Kizaki K, Patel OV, Nakano H, Takahashi T, Imai K, Hirasawa A, Shiojima S, Ikawa H, Suzuki Y, Tsujimoto G, Izaike Y, Todoroki J, Hashizume K. Characterization of gene expression profiles in early bovine pregnancy using a custom cDNA microarray. Mol Reprod Dev. 2003 May;65(1):9-18. PubMed PMID: 12658628.

There are no reviews yet.

Be the first to review “Cow PAG1B Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products