Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Andecaliximab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Andecaliximab ELISA Kit

Andecaliximab ELISA Kit

Product name Andecaliximab ELISA Kit
Uniprot ID P14780
Raw Antigen Sequence MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEMRGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYPFDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRSYSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYSACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYSTCTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSERPTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYWRFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRRLDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLDTHDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX184
Note For research use only.
Sample type Plasma, Serum
Target Andecaliximab
Immunogen Andecaliximab

Introduction

Andecaliximab is a novel antibody that has gained attention in the field of cancer research due to its potential as a therapeutic target. This antibody has shown promising results in preclinical studies and is currently being evaluated in clinical trials. To facilitate the detection and quantification of Andecaliximab, an ELISA kit has been developed. In this article, we will provide a scientific description of the structure, activity, and application of Andecaliximab ELISA kit.

Structure of Andecaliximab

Andecaliximab is a humanized monoclonal antibody that specifically targets the protein glycoprotein A33 (GPA33). It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 50 kDa. The heavy chains contain a constant region (Fc) and a variable region (Fab), while the light chains only have a variable region. The variable regions of Andecaliximab are responsible for binding to GPA33, while the constant regions are involved in immune effector functions.

Activity of Andecaliximab

Andecaliximab exerts its activity by binding to GPA33, a cell surface protein that is overexpressed in various types of cancers, including colorectal, pancreatic, and gastric cancer. By binding to GPA33, Andecaliximab inhibits its interaction with other proteins, leading to the inhibition of tumor growth and metastasis. Additionally, Andecaliximab can also induce antibody-dependent cell-mediated cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC), which further enhances its anti-tumor activity.

Application of Andecaliximab ELISA Kit

The Andecaliximab ELISA kit is a valuable tool for the detection and quantification of Andecaliximab in various biological samples, such as serum, plasma, and cell culture supernatant. This kit utilizes the sandwich ELISA technique, where Andecaliximab is captured by a specific antibody coated on the microplate wells, and then detected by a second antibody conjugated to an enzyme. The amount of Andecaliximab present in the sample is directly proportional to the color intensity, which can be measured using a spectrophotometer.

Advantages of Andecaliximab ELISA Kit

The Andecaliximab ELISA kit offers several advantages over traditional methods of antibody detection. Firstly, it is highly sensitive, with a detection limit of 0.1 ng/ml, making it suitable for the detection of low concentrations of Andecaliximab. Secondly, it has a wide dynamic range, allowing for the quantification of Andecaliximab in a broad range of concentrations. Additionally, this kit is easy to use, with a simple and fast protocol, making it suitable for high-throughput screening.

Clinical Applications of Andecaliximab ELISA Kit

The Andecaliximab ELISA kit has several clinical applications, including monitoring the pharmacokinetics of Andecaliximab in patients receiving treatment, assessing the level of Andecaliximab in serum or plasma to determine patient response, and evaluating the pharmacodynamics of Andecaliximab in preclinical and clinical studies. Furthermore, this kit can also be used to measure the presence of Andecaliximab in patient samples for the development of personalized treatment strategies.

Conclusion

In conclusion, Andecaliximab ELISA kit is a valuable tool for the detection and quantification of Andecaliximab, a promising therapeutic antibody targeting GPA33. This kit offers several advantages over traditional methods and has various clinical applications, making it an essential tool for researchers and clinicians in the field of cancer research. Further studies and clinical trials are needed to fully explore the potential of Andecaliximab as a therapeutic target and its application in personalized cancer treatment.

Andecaliximab ELISA Kit

There are no reviews yet.

Be the first to review “Andecaliximab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products