Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Brolucizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Brolucizumab ELISA Kit

Brolucizumab ELISA Kit

Product name Brolucizumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX188
Note For research use only.
Sample type Plasma, Serum
Target Brolucizumab
Immunogen Brolucizumab

Introduction to Brolucizumab ELISA Kit

Brolucizumab is a novel monoclonal antibody that has recently been approved by the US Food and Drug Administration (FDA) for the treatment of neovascular (wet) age-related macular degeneration (AMD). It is a promising therapeutic target due to its high affinity and specificity for vascular endothelial growth factor (VEGF), a key factor in the development of wet AMD. In order to measure the levels of Brolucizumab in patient samples, an ELISA (enzyme-linked immunosorbent assay) kit has been developed. In this article, we will discuss the structure, activity, and application of the Brolucizumab ELISA Kit.

Structure of Brolucizumab

Brolucizumab is a humanized monoclonal antibody that belongs to the IgG1 subclass. It is composed of two heavy chains and two light chains, each with a molecular weight of approximately 150 kDa. The heavy and light chains are linked by disulfide bonds and form a Y-shaped structure. The variable regions of the heavy and light chains are responsible for the binding of Brolucizumab to its target, VEGF.

Activity of Brolucizumab

Brolucizumab acts as an anti-VEGF agent by binding to VEGF and preventing it from binding to its receptor on the surface of endothelial cells. This inhibits the formation of new blood vessels, which is a key process in the development of wet AMD. Brolucizumab has a high binding affinity for VEGF, with a dissociation constant (Kd) of 6.7 pM. This allows it to effectively block the activity of VEGF and reduce the growth of abnormal blood vessels in the eye.

Application of Brolucizumab ELISA Kit

The Brolucizumab ELISA Kit is a highly sensitive and specific tool for the quantitative measurement of Brolucizumab in various biological samples, including serum, plasma, and tissue homogenates. It utilizes a sandwich ELISA format, where Brolucizumab is captured by a specific antibody coated on a microplate and then detected by a second antibody conjugated to an enzyme. The amount of Brolucizumab present in the sample is directly proportional to the color intensity produced by the enzyme reaction.

The Brolucizumab ELISA Kit has a wide dynamic range, allowing for the detection of Brolucizumab in a variety of sample concentrations. It also has a low detection limit of 0.1 ng/mL, making it a highly sensitive assay. This kit is a valuable tool for monitoring the levels of Brolucizumab in patients undergoing treatment for wet AMD, as well as for assessing the pharmacokinetics and pharmacodynamics of the drug.

Conclusion

In conclusion, Brolucizumab is a promising therapeutic target for the treatment of wet AMD. The Brolucizumab ELISA Kit provides a reliable and accurate method for the quantitative measurement of Brolucizumab in various biological samples. With its high sensitivity and specificity, this kit is a valuable tool for monitoring the levels of Brolucizumab in patients and for further research on this novel monoclonal antibody.

Brolucizumab ELISA Kit

There are no reviews yet.

Be the first to review “Brolucizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products