Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Imalumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Imalumab ELISA Kit

Imalumab ELISA Kit

Product name Imalumab ELISA Kit
Uniprot ID P14174
Raw Antigen Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX183
Note For research use only.
Sample type Plasma, Serum
Target Imalumab
Immunogen Imalumab

Introduction to Imalumab ELISA Kit

Imalumab is a novel antibody that has been identified as a potential therapeutic target for various inflammatory diseases. It is a human monoclonal antibody that specifically targets and inhibits the activity of the soluble form of the interleukin-6 receptor (sIL-6R). The Imalumab ELISA Kit is a highly sensitive and specific tool that is used for the quantitative detection of Imalumab in various biological samples. In this article, we will delve into the structure, activity, and applications of Imalumab ELISA Kit.

Structure of Imalumab

Imalumab is a fully human IgG1 monoclonal antibody with a molecular weight of approximately 150 kDa. It is composed of two heavy chains and two light chains, each consisting of variable and constant regions. The variable region of Imalumab is responsible for its specific binding to the sIL-6R, while the constant region is responsible for its effector functions, such as complement activation and antibody-dependent cell-mediated cytotoxicity.

Activity of Imalumab

The main activity of Imalumab is its ability to bind to the sIL-6R and inhibit its activity. The sIL-6R is a soluble form of the interleukin-6 receptor, which is a key mediator of inflammation and immune response. By binding to the sIL-6R, Imalumab prevents the interaction between the receptor and its ligand, interleukin-6, thereby inhibiting the downstream signaling pathways. This leads to a decrease in the production of pro-inflammatory cytokines and chemokines, ultimately reducing the inflammatory response.

In addition to its anti-inflammatory activity, Imalumab has also been shown to have a potential role in modulating the immune response. It can induce regulatory T cells and suppress the production of autoantibodies, making it a promising therapeutic candidate for autoimmune diseases.

Application of Imalumab ELISA Kit

The Imalumab ELISA Kit is a valuable tool for the quantitative detection of Imalumab in various biological samples. It is commonly used in research studies to measure the levels of Imalumab in serum, plasma, and cell culture supernatants. This allows researchers to monitor the pharmacokinetics and pharmacodynamics of Imalumab in preclinical and clinical studies.

Furthermore, the Imalumab ELISA Kit is also used in the development and quality control of Imalumab-based therapeutics. It can be used to assess the purity and potency of Imalumab preparations, ensuring their safety and efficacy for clinical use.

Conclusion

In summary, Imalumab is a promising therapeutic target for inflammatory diseases, and its specific detection and quantification are essential for its development and use. The Imalumab ELISA Kit is a highly sensitive and specific tool that enables the accurate measurement of Imalumab levels in various biological samples. Its application in research and development of Imalumab-based therapeutics makes it an indispensable tool for advancing our understanding and treatment of inflammatory diseases.

Imalumab ELISA Kit

There are no reviews yet.

Be the first to review “Imalumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products