Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Bevacizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Bevacizumab ELISA Kit

Bevacizumab ELISA Kit

Product name Bevacizumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°C)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX187
Note For research use only.
Sample type Plasma, Serum
Target Bevacizumab
Immunogen Bevacizumab

The Structure of Bevacizumab ELISA Kit

Bevacizumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) kit designed for the detection and quantification of Bevacizumab in biological samples. Bevacizumab, also known as Avastin, is a monoclonal antibody that targets vascular endothelial growth factor (VEGF) and is widely used as a therapeutic agent for various types of cancer.

The kit is composed of several components, including a microplate coated with a specific antibody against Bevacizumab, a biotinylated detection antibody, streptavidin-HRP conjugate, and a substrate solution. The microplate has 96 wells, each of which is pre-coated with a monoclonal antibody that specifically binds to Bevacizumab. The biotinylated detection antibody recognizes a different epitope on Bevacizumab and is conjugated to biotin for detection. The streptavidin-HRP conjugate binds to the biotinylated detection antibody, and the resulting complex is detected using a colorimetric substrate solution.

The Activity of Bevacizumab ELISA Kit

Bevacizumab ELISA Kit is a highly sensitive and specific assay that allows for the accurate quantification of Bevacizumab in biological samples. The kit has a detection limit of 0.1 ng/mL and a dynamic range of 0.5-100 ng/mL, making it suitable for the detection of Bevacizumab at various concentrations.

The principle of the assay is based on the sandwich ELISA technique, where the microplate is coated with a specific antibody against Bevacizumab. When a sample containing Bevacizumab is added to the microplate, the antibody binds to the target molecule, forming a Bevacizumab-antibody complex. The biotinylated detection antibody then binds to a different epitope on Bevacizumab, creating a sandwich complex. The streptavidin-HRP conjugate then binds to the biotinylated detection antibody, and the resulting complex is detected using a colorimetric substrate solution. The intensity of the color produced is directly proportional to the amount of Bevacizumab present in the sample.

The Application of Bevacizumab ELISA Kit

Bevacizumab ELISA Kit has a wide range of applications in both research and clinical settings. The kit is primarily used for the quantification of Bevacizumab in biological samples, such as serum, plasma, and cell culture supernatants. It is a valuable tool for monitoring the levels of Bevacizumab in patients undergoing treatment with the drug.

In research, Bevacizumab ELISA Kit is used to study the pharmacokinetics and pharmacodynamics of Bevacizumab, as well as its interactions with other molecules. It is also used to evaluate the efficacy of novel Bevacizumab-based therapies and to assess the expression of Bevacizumab in tumor tissues.

In clinical settings, Bevacizumab ELISA Kit is used for the early detection and monitoring of various types of cancer, including colorectal, lung, and breast cancer. It is also used to assess the response to Bevacizumab therapy and to guide treatment decisions.

In conclusion, Bevacizumab ELISA Kit is a highly sensitive and specific assay that allows for the accurate quantification of Bevacizumab in biological samples. Its structure, activity, and wide range of applications make it an essential tool for studying the role of Bevacizumab in cancer and for monitoring its levels in patients undergoing treatment.

Bevacizumab ELISA Kit

  • Hammer, M.; Herth, J.; Herbster, L.; Böhmann, M.B.; Muuss, M.; Khoramnia, R.; Scheuerle, A.; Mier, W.; Wohlfart, S.; Auffarth, G.U.; et al. In Vitro Physicochemical and Pharmacokinetic Properties of Bevacizumab Dissolved in Silicone Oils Compared to Hydrogel-Substitutes and Porcine Vitreous Bodies. Gels 2024, 10, 501. https://doi.org/10.3390/gels10080501
  • Wohlfart S, Herth J, Böhmann MB, et al. Exposure to silicone oil endotamponades induces VEGF antibody aggregation and loss of functionality. Invest Ophthalmol Vis Sci. 2024;65(13):56. https://doi.org/10.1167/iovs.65.13.56

There are no reviews yet.

Be the first to review “Bevacizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products