Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ranibizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Ranibizumab ELISA Kit

Ranibizumab ELISA Kit

Product name Ranibizumab ELISA Kit
Uniprot ID P15692
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX189
Note For research use only.
Sample type Plasma, Serum
Target Ranibizumab
Immunogen Ranibizumab

The Structure of Ranibizumab ELISA Kit

Ranibizumab ELISA Kit is a highly sensitive and specific assay designed for the quantitative determination of Ranibizumab in various biological samples. Ranibizumab is a humanized monoclonal antibody that specifically binds to vascular endothelial growth factor A (VEGF-A) and inhibits its activity. This makes Ranibizumab a crucial therapeutic target in the treatment of various ocular diseases, including age-related macular degeneration, diabetic macular edema, and macular edema following retinal vein occlusion.

The kit utilizes the principle of enzyme-linked immunosorbent assay (ELISA) to detect and quantify Ranibizumab. The ELISA technique involves the use of an enzyme-conjugated antibody that specifically binds to the target molecule and produces a colorimetric signal, which is then measured and correlated to the amount of the target molecule present in the sample.

The Ranibizumab ELISA Kit contains all the necessary components for the assay, including microtiter plates pre-coated with a monoclonal antibody against Ranibizumab, standards, controls, and reagents for sample preparation and detection. The monoclonal antibody used in the kit is highly specific for Ranibizumab and does not cross-react with other VEGF-A inhibitors or related proteins.

The Activity of Ranibizumab

Ranibizumab is a recombinant humanized monoclonal antibody that specifically binds to VEGF-A, a key regulator of angiogenesis and vascular permeability. VEGF-A is a potent inducer of neovascularization, which is essential for the growth and maintenance of blood vessels in the eye. However, excessive VEGF-A activity has been linked to various ocular diseases, including wet age-related macular degeneration, diabetic macular edema, and macular edema following retinal vein occlusion.

Ranibizumab exerts its therapeutic effect by binding to VEGF-A and inhibiting its interaction with its receptors on the surface of endothelial cells. This prevents the activation of downstream signaling pathways that promote the growth and permeability of blood vessels. By inhibiting VEGF-A activity, Ranibizumab helps reduce the formation of abnormal blood vessels and leakage of fluid into the retina, thereby improving vision and preventing further damage to the eye.

Application of Ranibizumab ELISA Kit

Ranibizumab ELISA Kit has a wide range of applications in the field of ophthalmology. It is primarily used for the quantitative determination of Ranibizumab in various biological samples, including serum, plasma, and vitreous fluid. This makes it a valuable tool for monitoring the pharmacokinetics of Ranibizumab in patients undergoing treatment with the drug.

The kit is also used in clinical trials to assess the efficacy of Ranibizumab in different ocular diseases. By measuring the levels of Ranibizumab in patient samples, researchers can evaluate the drug’s ability to inhibit VEGF-A activity and its correlation with clinical outcomes.

Moreover, Ranibizumab ELISA Kit is also used in the development and production of Ranibizumab biosimilars. Biosimilars are biological products that are highly similar to an approved reference product and have no clinically meaningful differences in terms of safety, purity, and potency. The accurate and reliable quantification of Ranibizumab provided by the ELISA kit is essential for ensuring the quality and consistency of biosimilars.

In conclusion, Ranibizumab ELISA Kit is a valuable tool for the detection and quantification of Ranibizumab in various biological samples. Its high sensitivity and specificity make it an essential assay for monitoring the pharmacokinetics of Ranibizumab in patients and assessing its efficacy in clinical trials. The kit’s application in the development and production of biosimilars also highlights its importance in ensuring the quality and consistency of these products.

Ranibizumab ELISA Kit

There are no reviews yet.

Be the first to review “Ranibizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products