Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ranibizumab Biosimilar – Anti-VEGF mAb – Research Grade

  • PX-TA1008-100UG
  • Validated ELISA FC
Isotype:
FabG1

Original price was: $288.00.Current price is: $238.00.

100ug 17% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade

Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Product name PX-TA1008-50
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Clonality Monoclonal Antibody
Product name Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade
Uniprot ID P15692
Source DrugBank DB01270
Species Human
Raw Antigen Sequence MTDRQTDTAPSPSYHLLPGRRRTVDAAASRGQGPEPAPGGGVEGVGARGVALKLFVQLLGCSRFGGAVVRAGEAEPSGAARSASSGREEPQPEEGEEEEEKEEERGPQWRLGARKPGSWTGEAAVCADSAPAARAPQALARASGRGGRVARRGAEESGPPHSPSRRGSASRAGPGRASETMNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 48kDa
Purity >85%
Buffer PBS pH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ranibizumab,Ranibizumab,VEGF,anti-VEGF
Reference PX-TA1008
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype FabG1
Clonality Monoclonal Antibody

General information about Ranibizumab

Ranibizumab is a monoclonal antibody fragment (Fab) created from the same parent mouse antibody as bevacizumab. It is an anti-angiogenic that has been approved to treat the “wet” type of age-related macular degeneration (AMD, also ARMD), diabetic retinopathy, and macular edema due to branch retinal vein occlusion or central retinal vein occlusion. This product is for research use only.

SDS-PAGE for Ranibizumab Biosimilar - Anti-VEGF mAb

SDS-PAGE for Ranibizumab Biosimilar - Anti-VEGF mAb

Ranibizumab Biosimilar - Anti-VEGF mAb, on SDS-PAGE under non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ranibizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Ranibizumab Biosimilar - Anti-VEGF mAb binds to VEGFA / VEGF165, C-His, recombinant protein in Indirect ELISA

Immobilized VEGFA / VEGF165, C-His, recombinant protein (cat. No.PX-P5977) at 0.5µg/mL (100µL/well) can bind Ranibizumab Biosimilar - Anti-VEGF mAb (cat. No.PX-TA1008) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 22.11M.

Ranibizumab Biosimilar - Anti-VEGF mAb - Research Grade

There are no reviews yet.

Be the first to review “Ranibizumab Biosimilar – Anti-VEGF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products