Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade

  • PX-TA1078-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $209.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Product name Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade
Uniprot ID Q04609
Source CAS 145464-28-4
Species Mus musculus
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Capromab,7E11-C5.3 radiolabelled,Indium In1111 ProstaScint-,capromab pendetide,FOLH2,anti-FOLH2
Reference PX-TA1078
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade
Uniprot ID Q04609
Source CAS 145464-28-4
Species Mus musculus
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Capromab,7E11-C5.3 radiolabelled,Indium In1111 ProstaScint-,capromab pendetide,FOLH2,anti-FOLH2
Reference PX-TA1078
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1078-50
Uniprot ID Q04609
Source CAS 145464-28-4
Species Mus musculus
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Capromab,7E11-C5.3 radiolabelled,Indium In1111 ProstaScint-,capromab pendetide,FOLH2,anti-FOLH2
Reference PX-TA1078
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar – Anti-FOLH2 mAb is a monoclonal antibody (mAb) that specifically targets the folate hydrolase 2 (FOLH2) protein. This biosimilar is a research grade version of the original Capromab, which was approved by the US Food and Drug Administration (FDA) in 1996 for the detection of prostate cancer. The biosimilar version offers a more affordable option for research purposes and has the potential to be developed into a therapeutic antibody for the treatment of various cancers.

Structure of Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar – Anti-FOLH2 mAb is a recombinant humanized IgG1 monoclonal antibody. It is composed of two identical heavy chains and two identical light chains, each with a molecular weight of approximately 150 kDa. The antibody has a Y-shaped structure, with two antigen-binding fragments (Fab) at the end of each arm and a constant fragment (Fc) at the base. The Fc region is responsible for the effector functions of the antibody, such as antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC).

Activity of Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar – Anti-FOLH2 mAb specifically binds to the FOLH2 protein, which is highly expressed on the surface of prostate cancer cells. The antibody recognizes a unique epitope on the FOLH2 protein and has a high affinity for it, allowing for efficient targeting and binding. This binding triggers a signaling cascade that leads to the activation of immune cells, resulting in the destruction of cancer cells through ADCC and CDC.

In addition to its diagnostic capabilities, Capromab Biosimilar – Anti-FOLH2 mAb has also shown promising results in preclinical studies as a therapeutic agent. It has been shown to inhibit the growth of prostate cancer cells and induce cell death through apoptosis. The antibody has also been found to enhance the effectiveness of chemotherapy and radiation therapy in prostate cancer treatment.

Application of Capromab Biosimilar – Anti-FOLH2 mAb

Capromab Biosimilar – Anti-FOLH2 mAb has a wide range of applications in both research and clinical settings. In research, the antibody can be used for the detection and quantification of FOLH2 expression in various cancer types, including prostate, bladder, and ovarian cancer. It can also be used to study the role of FOLH2 in cancer progression and to identify potential therapeutic targets.

In the clinical setting, Capromab Biosimilar – Anti-FOLH2 mAb has the potential to be developed into a therapeutic antibody for the treatment of prostate cancer and other FOLH2-expressing cancers. Its ability to specifically target cancer cells while sparing healthy cells makes it a promising candidate for cancer therapy. Additionally, the biosimilar version offers a more affordable option for patients and has the potential to increase access to this targeted treatment.

Conclusion

In summary, Capromab Biosimilar – Anti-FOLH2 mAb is a recombinant humanized monoclonal antibody that specifically targets the FOLH2 protein. It has a unique structure and high affinity for its target, making it an effective diagnostic and potentially therapeutic agent for various cancers. Its broad range of applications in research and clinical settings make it a valuable tool in the fight against cancer. With ongoing research and development, Capromab Biosimilar – Anti-FOLH2 mAb has the potential to improve cancer detection and treatment outcomes for patients.

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Flow Cytometry results for Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Capromab Biosimilar - Anti-FOLH2 mAb - Research Grade

There are no reviews yet.

Be the first to review “Capromab Biosimilar – Anti-FOLH2 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products