Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Rosopatamab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Rosopatamab ELISA Kit

Rosopatamab ELISA Kit

Product name Rosopatamab ELISA Kit
Uniprot ID Q04609
Raw Antigen Sequence MWNLLHETDSAVATARRPRWLCAGALVLAGGFFLLGFLFGWFIKSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX239
Note For research use only.
Sample type Plasma, Serum
Target Rosopatamab
Immunogen Rosopatamab

Introduction to Rosopatamab ELISA Kit

Rosopatamab ELISA Kit is a highly sensitive and specific tool used for the detection and quantification of Rosopatamab, a monoclonal antibody targeting a specific therapeutic target. This kit is widely used in the field of immunology and biotechnology for research and diagnostic purposes.

Structure of Rosopatamab

Rosopatamab is a humanized monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains consist of a constant region and a variable region, while the light chains consist of a constant region and a variable region. The variable regions of both the heavy and light chains are responsible for binding to the specific therapeutic target.

This antibody has a molecular weight of approximately 150 kDa and is composed of 1,330 amino acids. It is produced through recombinant DNA technology and has a high degree of purity, making it an ideal therapeutic agent for various diseases.

Activity of Rosopatamab

Rosopatamab acts as a potent inhibitor of its specific therapeutic target, thereby blocking its activity and preventing the progression of diseases associated with this target. The binding of Rosopatamab to its target also triggers an immune response, leading to the destruction of target cells and further enhancing its therapeutic activity.

Moreover, Rosopatamab has been shown to have a long half-life in the body, allowing for sustained therapeutic effects and reducing the need for frequent dosing. It also has a low immunogenicity, meaning it is less likely to trigger an immune response in patients, making it a safe and effective treatment option.

Application of Rosopatamab ELISA Kit

Rosopatamab ELISA Kit is primarily used for the detection and quantification of Rosopatamab in various biological samples, such as serum, plasma, and cell culture supernatants. This kit utilizes the principle of enzyme-linked immunosorbent assay (ELISA), where the antibody is immobilized on a solid surface and the target antigen is detected using a specific enzyme-conjugated secondary antibody.

One of the main applications of this kit is in the development and optimization of Rosopatamab-based therapies. By accurately measuring the levels of Rosopatamab in different samples, researchers can determine the optimal dosing and treatment regimen for maximum therapeutic efficacy.

Furthermore, Rosopatamab ELISA Kit is also used in clinical settings for the diagnosis and monitoring of diseases associated with the specific therapeutic target. By detecting the levels of Rosopatamab in patient samples, healthcare professionals can assess the response to treatment and make necessary adjustments to improve patient outcomes.

Conclusion

In summary, Rosopatamab ELISA Kit is a valuable tool in the field of immunology and biotechnology for the detection and quantification of Rosopatamab, a monoclonal antibody targeting a specific therapeutic target. Its high sensitivity, specificity, and ease of use make it an essential component in the development and optimization of Rosopatamab-based therapies. Furthermore, its application in clinical settings allows for accurate diagnosis and monitoring of diseases associated with the specific therapeutic target. With its growing use and advancements in technology, Rosopatamab ELISA Kit is expected to play a significant role in the advancement of immunotherapy and personalized medicine.

Rosopatamab ELISA Kit

There are no reviews yet.

Be the first to review “Rosopatamab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products