Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ifinatamab Biosimilar – Anti-CD276 mAb – Research Grade

  • PX-TA1847-100
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $295.00.Current price is: $238.00.

100ug 19% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

Product name Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ifinatamab,,CD276,anti-CD276
Reference PX-TA1847
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade
Uniprot ID Q5ZPR3
Species Homo Sapiens
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ifinatamab,,CD276,anti-CD276
Reference PX-TA1847
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1 Kappa
Clonality Monoclonal Antibody
Product name PX-TA1847-50
Uniprot ID Q5ZPR3
Species Homo Sapiens
Raw Antigen Sequence MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ifinatamab,,CD276,anti-CD276
Reference PX-TA1847
Note For research use only. Not suitable for human use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Ifinatamab Biosimilar is a monoclonal antibody (mAb) that targets CD276, a protein found on the surface of cancer cells. This biosimilar is designed to mimic the structure and function of an existing anti-CD276 mAb, providing a more affordable option for researchers studying this therapeutic target.

Structure

Ifinatamab Biosimilar is a recombinant humanized IgG1 monoclonal antibody. It is composed of two heavy chains and two light chains, each containing a variable region that specifically binds to CD276. The constant region of the antibody is responsible for its effector functions, such as activating the immune system to attack cancer cells.

Activity

As an anti-CD276 mAb, Ifinatamab Biosimilar works by binding to CD276 on the surface of cancer cells. This prevents the protein from interacting with its receptors, which are involved in promoting cancer cell growth and survival. By blocking this interaction, Ifinatamab Biosimilar helps to inhibit the growth and spread of cancer cells.

In addition, Ifinatamab Biosimilar can also activate the immune system to attack cancer cells. This is achieved through the antibody’s Fc region, which binds to immune cells and triggers them to release substances that can kill cancer cells. This dual mechanism of action makes Ifinatamab Biosimilar a potent anti- cancer agent.

Application

Ifinatamab Biosimilar is primarily used in research settings to study the role of CD276 in cancer and to develop potential therapies targeting this protein. It can be used in various in vitro and in vivo experiments, including cell culture studies, animal models, and clinical trials.

One potential application of Ifinatamab Biosimilar is in combination with other cancer treatments. By targeting CD276, this biosimilar can enhance the efficacy of other therapies, such as chemotherapy and radiation, in killing cancer cells. This has the potential to improve treatment outcomes for cancer patients.

Conclusion

Ifinatamab Biosimilar is a promising research tool for studying CD276, a therapeutic target involved in cancer growth and survival. Its structure and activity as an anti-CD276 mAb make it a valuable addition to the scientific community’s arsenal of tools for understanding and treating cancer. With its affordable cost and potential for combination therapy, Ifinatamab Biosimilar has the potential to make a significant impact in the fight against cancer.

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade binds to CD276 Recombinant Protein in ELISA assay

Immobilized CD276 Recombinant Protein (cat. No.PX-P4125) at 0.5µg/mL (100µL/well) can bind Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade (cat. No.PX-TA1847) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 71.68M.

Flow Cytometry results for Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

Flow Cytometry results for Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Ifinatamab Biosimilar - Anti-CD276 mAb - Research Grade

There are no reviews yet.

Be the first to review “Ifinatamab Biosimilar – Anti-CD276 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products