Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Birtamimab Biosimilar – Anti-SAA1 mAb – Research Grade

  • PX-TA1428-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $205.00.Current price is: $167.00.

50ug 19% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade

Product name Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS 1608108-91-3
Species Humanized
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Birtamimab,2A4,ELT1-01,NEOD-001,SAA1,anti-SAA1
Reference PX-TA1428
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS 1608108-91-3
Species Humanized
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Birtamimab,2A4,ELT1-01,NEOD-001,SAA1,anti-SAA1
Reference PX-TA1428
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1428-50
Uniprot ID P0DJI8
Source CAS 1608108-91-3
Species Humanized
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Birtamimab,2A4,ELT1-01,NEOD-001,SAA1,anti-SAA1
Reference PX-TA1428
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-SAA1[Homo sapiens] (Birtamimab) Monoclonal Antibody

Birtamimab is investigated for the treatment of AL Amyloidosis.

SDS-PAGE for Birtamimab Biosimilar - Anti-SAA1 mAb

SDS-PAGE for Birtamimab Biosimilar - Anti-SAA1 mAb

Birtamimab Biosimilar - Anti-SAA1 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

SEC-HPLC of Birtamimab Biosimilar - Anti-SAA mAb - Research Grade

SEC-HPLC of Birtamimab Biosimilar - Anti-SAA mAb - Research Grade

Birtamimab Biosimilar - Anti-SAA mAb - Research Gradewas analyzed by size exclusion chromatography with UV detection.

Birtamimab Biosimilar - Anti-SAA1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Birtamimab Biosimilar – Anti-SAA1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products