Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Landogrozumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade

  • PX-TA1403-50
  • Validated FC
Isotype:
IgG4, Kappa

Original price was: $224.00.Current price is: $167.00.

50ug 25% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

Product name Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1391726-30-9
Species Humanized
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Landogrozumab,LY-2495655,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1403
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade
Uniprot ID O14793
Source CAS 1391726-30-9
Species Humanized
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Landogrozumab,LY-2495655,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1403
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1403-50
Uniprot ID O14793
Source CAS 1391726-30-9
Species Humanized
Raw Antigen Sequence MQKLQLCVYIYLFMLIVAGPVDLNENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Landogrozumab,LY-2495655,MSTN, GDF8,anti-MSTN, GDF8
Reference PX-TA1403
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa

General information on Anti-MSTN/GDF8[Homo sapiens] (Landogrozumab) Monoclonal Antibody

Landogrozumab has been investigated for the treatment of Advanced Cancer, Muscular Atrophy, and Pancreatic Cancer.

SDS-PAGE for Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb

SDS-PAGE for Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb

Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb, on SDS-PAGE under reducing and non-reducing condition. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Landogrozumab Biosimilar - Anti-MSTN; GDF8 mAb - Research Grade

Flow Cytometry results for Landogrozumab Biosimilar - Anti-MSTN; GDF8 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Landogrozumab Biosimilar - Anti-MSTN; GDF8 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Landogrozumab Biosimilar - Anti-MSTN, GDF8 mAb - Research Grade

There are no reviews yet.

Be the first to review “Landogrozumab Biosimilar – Anti-MSTN, GDF8 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products