Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Vandortuzumab Biosimilar – Anti-STEAP1 mAb – Research Grade

  • PX-TA1370-100UG
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $286.00.Current price is: $238.00.

100ug 17% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

Product name Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade
Uniprot ID Q9UHE8
Source CAS 1471985-92-8
Species Humanized
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Vandortuzumab,DSTP-3086S,DSTP3086S,MSTP2109A,RG-7450,RG7450,STEAP1,anti-STEAP1
Reference PX-TA1370
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade
Uniprot ID Q9UHE8
Source CAS 1471985-92-8
Species Humanized
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Vandortuzumab,DSTP-3086S,DSTP3086S,MSTP2109A,RG-7450,RG7450,STEAP1,anti-STEAP1
Reference PX-TA1370
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1370-50
Uniprot ID Q9UHE8
Source CAS 1471985-92-8
Species Humanized
Raw Antigen Sequence MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Vandortuzumab,DSTP-3086S,DSTP3086S,MSTP2109A,RG-7450,RG7450,STEAP1,anti-STEAP1
Reference PX-TA1370
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction

Vandortuzumab Biosimilar, also known as Anti-STEAP1 mAb, is a monoclonal antibody that has been developed as a potential therapeutic agent for the treatment of various cancers. This biosimilar is a highly specific and potent antibody that targets the STEAP1 protein, which is overexpressed in many cancer types. In this article, we will discuss the structure, activity, and potential applications of Vandortuzumab Biosimilar in cancer treatment.

Structure of Vandortuzumab Biosimilar

Vandortuzumab Biosimilar is a recombinant, humanized monoclonal antibody that is produced using state-of-the-art biotechnology techniques. It is composed of two identical heavy chains and two identical light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to the target protein, STEAP1, while the constant regions play a role in the antibody’s effector functions.

Activity of Vandortuzumab Biosimilar

The main function of Vandortuzumab Biosimilar is to specifically bind to the STEAP1 protein, which is overexpressed in many types of cancer cells. This binding leads to the inhibition of the protein’s activity, which is essential for cancer cell survival and growth. By blocking STEAP1, Vandortuzumab Biosimilar effectively slows down the growth and proliferation of cancer cells, ultimately leading to their death.

In addition to its direct anti-tumor activity, Vandortuzumab Biosimilar also has effector functions that can enhance the body’s immune response against cancer cells. This includes activating immune cells such as natural killer cells and macrophages, which can then attack and destroy cancer cells.

Therapeutic Target: STEAP1

STEAP1, or six-transmembrane epithelial antigen of prostate 1, is a transmembrane protein that is highly expressed in many cancer types, including prostate, breast, lung, and ovarian cancer. It is involved in several cellular processes, including iron transport and regulation of cell proliferation and survival. However, in cancer cells, STEAP1 is overexpressed and plays a crucial role in promoting tumor growth and metastasis.

As a therapeutic target, STEAP1 has attracted significant attention due to its high expression in cancer cells and minimal expression in normal tissues. This makes it an ideal target for specific and targeted therapies, such as Vandortuzumab Biosimilar.

Applications of Vandortuzumab Biosimilar

Vandortuzumab Biosimilar is currently being evaluated in preclinical and clinical studies for the treatment of various cancers. This includes prostate, breast, lung, and ovarian cancer, where STEAP1 is highly expressed. The biosimilar is being studied as a monotherapy and in combination with other anti- cancer agents, such as chemotherapy and immune checkpoint inhibitors.

In addition to its potential as a cancer treatment, Vandortuzumab Biosimilar also has potential applications in diagnostic imaging. As STEAP1 is overexpressed in many cancer types, the antibody can be used to detect and visualize tumors using imaging techniques such as positron emission tomography (PET) and single-photon emission computed tomography (SPECT).

Conclusion

Vandortuzumab Biosimilar, also known as Anti-STEAP1 mAb, is a promising therapeutic agent for the treatment of various cancers. Its highly specific and potent activity against the STEAP1 protein makes it an ideal targeted therapy, with the potential for minimal side effects. With ongoing research and clinical trials, Vandortuzumab Biosimilar has the potential to improve the outcomes of cancer patients and contribute to the advancement of cancer treatment.

SDS-PAGE for Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

SDS-PAGE for Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade binds to Recombinant Human STEAP1 Protein, N-GST in ELISA Assay

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade binds to Recombinant Human STEAP1 Protein, N-GST in ELISA Assay

Recombinant Human STEAP1 Protein, N-GST(cat. No.ARO-P15431) at 0.5µg/mL (100µL/well) can bind Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade in indirect ELISA with Goat secondary antibody measured by OD450.

Vandortuzumab Biosimilar - Anti-STEAP1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Vandortuzumab Biosimilar – Anti-STEAP1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products