Skip to main content
Contact +1 (919) 234-1277

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25
Brand: ProteoGenix

Human Serum amyloid A-1 protein(SAA1) Recombinant Protein

Host species:
Escherichia coli (E.coli)
Origin species:
Homo sapiens (Human)
Uniprot ID:
P0DJI8
Molecular weight:
13.2 kDa

$250.00

50ug + 250 loyalty points
Partial Yes
size
Clear
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Human Serum amyloid A-1 protein(SAA1) Recombinant Protein

Human Serum amyloid A-1 protein(SAA1) Recombinant Protein

Product name Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
Uniprot ID P0DJI8
Uniprot link http://www.uniprot.org/uniprot/P0DJI8
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Molecular weight 13.2 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer Tris-HC 50mMl, NaCl 150mM, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:NCBI Gene Aliases SAA1
NCBI Reference P0DJI8
Aliases /Synonyms Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA
Reference PX-P3003
Note For research use only
Molecular Constructor
Partial Yes
Product name Human Serum amyloid A-1 protein(SAA1) Recombinant Protein
Uniprot ID P0DJI8
Uniprot link http://www.uniprot.org/uniprot/P0DJI8
Origin species Homo sapiens (Human)
Expression system Prokaryotic expression
Sequence MNHKVHHHHHHMRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Molecular weight 13.2 kDa
Protein delivered with Tag? Yes
Purity estimated 90%
Buffer Tris-HC 50mMl, NaCl 150mM, pH7.5
Form Frozen
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Partial
Spec:NCBI Gene Aliases SAA1
NCBI Reference P0DJI8
Aliases /Synonyms Serum amyloid A-1 protein, SAA, Amyloid fibril protein AA
Reference PX-P3003
Note For research use only
Molecular Constructor
Partial Yes

There are no reviews yet.

Be the first to review “Human Serum amyloid A-1 protein(SAA1) Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products