Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Anselamimab Biosimilar – Anti-Serum amyloid A-1 mAb – Research Grade

  • PX-TA1775-50
  • Validated ELISA
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade

Product name Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS: 2414866-63-8
Species Chimeric
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Anselamimab,11-1F4,,Serum amyloid A-1,anti-Serum amyloid A-1
Reference PX-TA1775
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade
Uniprot ID P0DJI8
Source CAS: 2414866-63-8
Species Chimeric
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Anselamimab,11-1F4,,Serum amyloid A-1,anti-Serum amyloid A-1
Reference PX-TA1775
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1775-50
Uniprot ID P0DJI8
Source CAS: 2414866-63-8
Species Chimeric
Raw Antigen Sequence MKLLTGLVFCSLVLGVSSRSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGAWAAEVITDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Anselamimab,11-1F4,,Serum amyloid A-1,anti-Serum amyloid A-1
Reference PX-TA1775
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Anselamimab Biosimilar: A Promising Antibody for Treating Serum Amyloid A-1 Related Diseases Serum amyloid A (SAA) is a protein that plays a crucial role in the body’s immune response to injury and infection. However, excessive production of SAA can lead to the formation of amyloid fibrils, which are associated with various diseases such as rheumatoid arthritis, atherosclerosis, and systemic amyloidosis. Anselamimab Biosimilar, also known as Anti-Serum amyloid A-1 mAb, is a novel therapeutic antibody that has shown promising results in targeting and neutralizing SAA. In this article, we will discuss the structure, activity, and potential applications of Anselamimab Biosimilar as a research-grade antibody.

Structure of Anselamimab Biosimilar

Anselamimab Biosimilar is a monoclonal antibody, meaning it is produced from a single clone of cells and has a specific target. It is a biosimilar version of the original Anselamimab antibody, which was developed by the pharmaceutical company Novartis. The biosimilar version is created using recombinant DNA technology, where the gene for Anselamimab is inserted into a host cell, such as Chinese hamster ovary (CHO) cells, to produce large quantities of the antibody.

The structure of Anselamimab Biosimilar is similar to that of the original Anselamimab antibody, with a heavy and light chain joined together by disulfide bonds. The heavy chain consists of a constant region and a variable region, while the light chain only has a variable region. The variable regions of both chains are responsible for binding to the target SAA protein.

Mechanism of Action

Anselamimab Biosimilar works by specifically targeting and binding to SAA, preventing it from forming amyloid fibrils. It does this by binding to a specific region of SAA, known as the amyloidogenic region, which is responsible for the formation of amyloid fibrils. By binding to this region, Anselamimab Biosimilar blocks the aggregation of SAA and promotes its clearance from the body.

Additionally, Anselamimab Biosimilar also has anti-inflammatory properties, as it can bind to and neutralize pro-inflammatory cytokines that are released by SAA. This dual mechanism of action makes Anselamimab Biosimilar a promising therapeutic option for diseases associated with SAA, where both the prevention of amyloid formation and the reduction of inflammation are crucial.

Potential Applications

As a research-grade antibody, Anselamimab Biosimilar is primarily used in laboratory studies to investigate the role of SAA in various diseases and to test its efficacy in treating these diseases. However, based on its promising results in preclinical studies, Anselamimab Biosimilar is also being considered for clinical trials as a potential therapeutic for SAA-related diseases.

One of the most significant potential applications of Anselamimab Biosimilar is in the treatment of systemic amyloidosis, a rare and life-threatening disease caused by the accumulation of amyloid fibrils in various organs. Currently, there is no effective treatment for this disease, and Anselamimab Biosimilar could offer a much-needed solution.

Other potential applications of Anselamimab Biosimilar include treating atherosclerosis, a condition where plaque buildup in the arteries can lead to heart disease, and rheumatoid arthritis, an autoimmune disease that causes chronic inflammation in the joints. Both of these diseases have been linked to high levels of SAA, making Anselamimab Biosimilar a promising therapeutic target.

Conclusion

In summary, Anselamimab Biosimilar is a monoclonal antibody that specifically targets and neutralizes SAA, a protein involved in various diseases. Its unique structure and dual mechanism of action make

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade in ELISA Assay

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade in ELISA Assay

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Anselamimab Biosimilar - Anti-Serum amyloid A-1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Anselamimab Biosimilar – Anti-Serum amyloid A-1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products