Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Iscalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade

  • PX-TA1503-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

Product name Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2031153-61-2
Species Homo sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Iscalimab,CFZ-533,NVP-CFZ533,OM11-62MF,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1503
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade
Uniprot ID P25942
Source CAS 2031153-61-2
Species Homo sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Iscalimab,CFZ-533,NVP-CFZ533,OM11-62MF,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1503
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1503-50
Uniprot ID P25942
Source CAS 2031153-61-2
Species Homo sapiens
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Iscalimab,CFZ-533,NVP-CFZ533,OM11-62MF,CD40, TNFRSF5,anti-CD40, TNFRSF5
Reference PX-TA1503
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

I.

Introduction

II.

Structure of Iscalimab Biosimilar

III.

Mechanism of Action

IV.

Therapeutic Target: CD40 V. Clinical Applications

VI.

Conclusion

I.

Introduction

Iscalimab Biosimilar is a novel therapeutic antibody that targets CD40, a protein found on the surface of immune cells. This biosimilar is designed to mimic the function of an existing monoclonal antibody, TNFRSF5 mAb, which is used in the treatment of autoimmune diseases. In this article, we will delve into the structure, mechanism of action, and clinical applications of Iscalimab Biosimilar.

II.

Structure of Iscalimab Biosimilar

Iscalimab Biosimilar is a monoclonal antibody, meaning it is produced by a single clone of cells. It is a humanized antibody, which means it contains both human and non-human components. The antibody is composed of two heavy chains and two light chains, connected by disulfide bonds. The heavy chains contain a constant region and a variable region, while the light chains only have a variable region. The variable regions are responsible for binding to the target protein, CD40.

III.

Mechanism of Action

Iscalimab Biosimilar works by binding to CD40 on the surface of immune cells, specifically B cells and dendritic cells. This binding prevents the interaction between CD40 and its ligand, CD154, which is crucial for the activation of immune cells. By blocking this interaction, Iscalimab Biosimilar inhibits the activation and proliferation of B cells, as well as the maturation and activation of dendritic cells. This ultimately leads to a decrease in the production of pro-inflammatory cytokines and antibodies, thus reducing the symptoms of autoimmune diseases.

IV.

Therapeutic Target: CD40

CD40 is a protein belonging to the tumor necrosis factor receptor superfamily. It is primarily expressed on the surface of immune cells, including B cells, dendritic cells, and macrophages. CD40 plays a critical role in regulating the immune response by promoting the activation and differentiation of immune cells. However, in autoimmune diseases, the overactivation of CD40 signaling can lead to excessive inflammation and tissue damage. Therefore, CD40 has been identified as a therapeutic target for the treatment of autoimmune diseases.

V. Clinical Applications

Iscalimab Biosimilar is currently being investigated for the treatment of various autoimmune diseases, including rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. In a phase II clinical trial for rheumatoid arthritis, Iscalimab Biosimilar showed promising results in reducing disease activity and improving symptoms. It is also being studied in combination with other therapies, such as methotrexate, to enhance its efficacy.

VI.

Conclusion

In conclusion, Iscalimab Biosimilar is a novel therapeutic antibody that targets CD40, a protein involved in the pathogenesis of autoimmune diseases. Its unique mechanism of action and promising results in clinical trials make it a potential treatment option for various autoimmune diseases. Further research and clinical trials are needed to fully understand the efficacy and safety of this biosimilar.

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb binds to CD40 Recombinant Protein in indirect ELISA Assay

Immobilized CD40 Recombinant Protein (cat. No.PX-P4082) at 0.5µg/mL (100µL/well) can bind to Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb (cat. No.PX-TA1503) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Iscalimab Biosimilar - Anti-CD40, TNFRSF5 mAb - Research Grade

There are no reviews yet.

Be the first to review “Iscalimab Biosimilar – Anti-CD40, TNFRSF5 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products