Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Ravagalimab Biosimilar – Anti-CD40, TNFRSF mAb – Research Grade

  • PX-TA1510-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $228.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade

Product name Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade
Uniprot ID P25942
Source CAS 2050816-56-1
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Ravagalimab,ABBV-323,CD40, TNFRSF,anti-CD40, TNFRSF
Reference PX-TA1510
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade
Uniprot ID P25942
Source CAS 2050816-56-1
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Ravagalimab,ABBV-323,CD40, TNFRSF,anti-CD40, TNFRSF
Reference PX-TA1510
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1510-50
Uniprot ID P25942
Source CAS 2050816-56-1
Species Humanized
Raw Antigen Sequence MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Ravagalimab,ABBV-323,CD40, TNFRSF,anti-CD40, TNFRSF
Reference PX-TA1510
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Ravagalimab Biosimilar: A Promising Anti-CD40, TNFRSF mAb for Research Introduction

Ravagalimab Biosimilar, also known as anti-CD40, TNFRSF mAb, is a monoclonal antibody (mAb) that has gained significant attention in the field of immunology and cancer research. This biosimilar is a potential therapeutic agent that targets CD40, a member of the tumor necrosis factor receptor superfamily (TNFRSF). In this article, we will discuss the structure, activity, and potential applications of Ravagalimab Biosimilar in research.

Structure of Ravagalimab Biosimilar

Ravagalimab Biosimilar is a recombinant humanized IgG1 mAb that is produced by genetic engineering techniques. It is composed of two heavy chains and two light chains, each containing variable and constant regions. The variable regions of the antibody are responsible for binding to its target, CD40, while the constant regions play a role in mediating effector functions.

The amino acid sequence of Ravagalimab Biosimilar is highly similar to the original drug, making it a suitable biosimilar with comparable efficacy and safety profiles. It has a molecular weight of approximately 150 kDa and a half-life of 21 days, making it a long-acting antibody.

Activity of Ravagalimab Biosimilar

Ravagalimab Biosimilar exerts its activity by binding to CD40, a cell surface receptor that is expressed on various immune cells, including B cells, dendritic cells, and macrophages. CD40 plays a crucial role in regulating immune responses, including B cell activation, T cell priming, and cytokine production.

By binding to CD40, Ravagalimab Biosimilar blocks the interaction between CD40 and its ligand, CD154. This disrupts the signaling pathway and inhibits the activation of immune cells, leading to suppression of inflammatory responses. Additionally, Ravagalimab Biosimilar can also induce antibody-dependent cellular cytotoxicity (ADCC) and complement-dependent cytotoxicity (CDC) against CD40-expressing cells.

Potential Applications of Ravagalimab Biosimilar

Ravagalimab Biosimilar has shown promising results in preclinical studies and is currently being evaluated in clinical trials for various indications. Some potential applications of this biosimilar are discussed below:

Cancer Immunotherapy CD40 is overexpressed on the surface of many

cancer cells, making it an attractive therapeutic target for cancer immunotherapy. Ravagalimab Biosimilar has demonstrated potent anti-tumor effects in preclinical models, both as a single agent and in combination with other therapies. It has the potential to enhance immune responses against cancer cells and improve the efficacy of existing cancer treatments.

Inflammatory Diseases

The dysregulation of CD40 signaling has been implicated in various inflammatory diseases, such as rheumatoid arthritis, systemic lupus erythematosus, and multiple sclerosis. By targeting CD40, Ravagalimab Biosimilar has the potential to modulate immune responses and alleviate symptoms of these diseases. Clinical trials are currently ongoing to evaluate its efficacy in these indications.

Transplantation

CD40-CD154 interaction is crucial for the activation of T cells, which play a major role in graft rejection after organ transplantation. Ravagalimab Biosimilar has shown promising results in preclinical models of transplantation by inhibiting T cell activation and prolonging graft survival. It has the potential to be used as an immunosuppressive agent in transplantation.

Conclusion

In summary, Ravagalimab Biosimilar is a promising anti-CD40, TNFRSF mAb that has the potential to be used in various research applications. Its structure, activity, and potential applications make it a valuable tool for understanding the role of CD40 in immune responses and developing novel therapies for immune-related diseases. Further clinical studies are needed to fully explore the therapeutic potential of

SDS-PAGE for Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

SDS-PAGE for Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade in ELISA Assay

Ravagalimab Biosimilar - Anti-CD40;TNFRSF5 mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Ravagalimab Biosimilar - Anti-CD40, TNFRSF mAb - Research Grade

There are no reviews yet.

Be the first to review “Ravagalimab Biosimilar – Anti-CD40, TNFRSF mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products