Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Gatralimab Biosimilar – Anti-CD52 mAb – Research Grade

  • PX-TA1589-50
  • Validated ELISA FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $215.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade

Product name Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Species Chimeric,Humanized
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Gatralimab ,GZ-402668,CD52,anti-CD52
Reference PX-TA1589
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Species Chimeric,Humanized
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Gatralimab ,GZ-402668,CD52,anti-CD52
Reference PX-TA1589
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1589-50
Uniprot ID P31358
Species Chimeric,Humanized
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Gatralimab ,GZ-402668,CD52,anti-CD52
Reference PX-TA1589
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Gatralimab Biosimilar

Gatralimab Biosimilar, also known as Anti-CD52 monoclonal antibody, is a research grade antibody that has shown promising results in the treatment of various diseases. It is a biosimilar of the FDA-approved drug, Alemtuzumab, which is used to treat chronic lymphocytic leukemia and multiple sclerosis. Gatralimab Biosimilar is a highly specific and potent antibody that targets the CD52 protein, making it a valuable therapeutic tool for a wide range of applications.

Structure of Gatralimab Biosimilar

Gatralimab Biosimilar is a humanized monoclonal antibody, meaning that it is derived from human cells and has been modified to reduce the risk of immune reactions. It consists of two heavy chains and two light chains, which are joined together by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of 7-9 days in the human body. The structure of Gatralimab Biosimilar has been carefully designed to ensure its stability and efficacy in targeting CD52.

Activity of Gatralimab Biosimilar

The main activity of Gatralimab Biosimilar is its ability to bind to the CD52 protein, which is found on the surface of certain immune cells, such as T and B lymphocytes, monocytes, and macrophages. By binding to CD52, Gatralimab Biosimilar triggers a series of events that lead to the destruction of these cells, making it an effective immunosuppressant. This mechanism of action is particularly useful in treating diseases where the immune system is overactive, such as autoimmune disorders and organ transplant rejection. Applications of Gatralimab Biosimilar Gatralimab Biosimilar has a wide range of potential applications in the field of medicine. Its primary use is in the treatment of autoimmune diseases, such as multiple sclerosis, rheumatoid arthritis, and lupus. In these conditions, the immune system mistakenly attacks healthy cells, causing inflammation and tissue damage. By targeting CD52, Gatralimab Biosimilar can suppress the immune response and reduce the severity of symptoms.

Another potential application of Gatralimab Biosimilar is in organ transplantation. When a new organ is transplanted into a patient, the body’s immune system recognizes it as foreign and tries to reject it. This can lead to organ failure and the need for a second transplant. By using Gatralimab Biosimilar, doctors can suppress the immune response and prevent rejection, increasing the success rate of organ transplants.

In addition to its use in treating diseases, Gatralimab Biosimilar also has potential in research and diagnostic applications. Its high specificity and potency make it a valuable tool for studying the role of CD52 in various diseases and for developing diagnostic tests for CD52-related conditions.

Conclusion

In summary, Gatralimab Biosimilar is a highly specific and potent antibody that targets the CD52 protein. Its structure and activity make it a valuable therapeutic tool for the treatment of autoimmune diseases and organ transplant rejection. It also has potential applications in research and diagnostics. As more studies are conducted, Gatralimab Biosimilar may prove to be a valuable addition to the arsenal of treatments for various diseases.

SDS-PAGE for Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade

SDS-PAGE for Gatralimab  Biosimilar - Anti-CD52 mAb - Research Grade

Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade

Flow Cytometry results for Gatralimab  Biosimilar - Anti-CD52 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Gatralimab Biosimilar - Anti-CD52 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Gatralimab  Biosimilar - Anti-CD52 mAb - Research Grade

There are no reviews yet.

Be the first to review “Gatralimab Biosimilar – Anti-CD52 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products