Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD52 Recombinant Protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
P31358
Molecular weight:
40kDa

$380.00

100ug + 380 loyalty points
Met1–Ser36 Fc
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD52 Recombinant Protein

Product name CD52 Recombinant Protein
Uniprot ID P31358
Uniprot link http://www.uniprot.org/uniprot/P31358
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPS
Molecular weight 40kDa
Protein delivered with Tag? C-terminal Fc Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Storage condition Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Ser36
Aliases /Synonyms CDW52, HE5
Reference PX-P4084
Note For research use only
Molecular Constructor
Met1–Ser36 Fc

General information on CD52 Recombinant Protein:

CD52 / CDW52 are small glycosyl phosphatidylinositol (GPI) anchor glycoproteins. It has a mature peptide containing only 12 amino acids and is expressed in large numbers on human lymphocytes. From a clinical point of view, this protein is an important target for therapeutic intervention for leukopenia in haematological neoplasms and post transplant immunosuppression. CD52 / CDW52 may play a role in carbohydrate transport and targeting. It is an excellent target for complement mediated cell lysis.

There are no reviews yet.

Be the first to review “CD52 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products