Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Alemtuzumab Biosimilar – Anti-CD52 mAb – Research Grade

  • PX-TA1035-100UG
  • Validated FC
Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $312.00.Current price is: $238.00.

100ug 24% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

Product name Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Source CAS 216503-57-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Alemtuzumab,Campath-1H,LDP-03,CD52,anti-CD52
Reference PX-TA1035
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade
Uniprot ID P31358
Source CAS 216503-57-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Alemtuzumab,Campath-1H,LDP-03,CD52,anti-CD52
Reference PX-TA1035
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA1035-50
Uniprot ID P31358
Source CAS 216503-57-0
Species Humanized
Expression system Mammalian cells
Raw Antigen Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS
Molecular weight 150kDa
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Alemtuzumab,Campath-1H,LDP-03,CD52,anti-CD52
Reference PX-TA1035
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

General information on Anti-CD52(Homo sapiens) (Alemtuzumab) Monoclonal Antibody

Alemtuzumab is a recombinant humanized monoclonal antibody (Campath-1H), which targets the 21-28 kD cell surface glycoprotein CD52. The Campath-1H antibody is of isotype IgG1, with human variable framework and constant regions, and a complementarity determining region derived from a murine (rat) monoclonal antibody (Campath-1G).

SDS-PAGE for Alemtuzumab Biosimilar - Anti-CD52 mAb

SDS-PAGE for Alemtuzumab Biosimilar - Anti-CD52 mAb

Alemtuzumab Biosimilar - Anti-CD52 mAb, on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Flow Cytometry results for Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

Flow Cytometry results for Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

Target Cells were stained with an irrelevant antibody or Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade at a concentration of 5 µg/ml for 30 mins at RT. After washing, bound antibody was detected using Goat Anti-Human IgG Polyclonal Antibody, FITC (PTX18862) and cells analysed on a NovoCyte Flow Cytometer.

Alemtuzumab Biosimilar - Anti-CD52 mAb - Research Grade

There are no reviews yet.

Be the first to review “Alemtuzumab Biosimilar – Anti-CD52 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products