Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Izuralimab Biosimilar – Anti-ICOS;PDCD1 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa

Original price was: $230.00.Current price is: $167.00.

50ug 27% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade

Product name Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade
Uniprot ID Q9Y6W8 & Q15116
Source CAS 2329669-80-7
Species Humanized
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Izuralimab,IZURALIMAB, XMAB23104, XMAB-23104,,ICOS;PDCD1,anti-ICOS;PDCD1
Reference PX-TA1675
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa
Clonality Monoclonal Antibody
Product name Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade
Uniprot ID Q9Y6W8 & Q15116
Source CAS 2329669-80-7
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Izuralimab,IZURALIMAB, XMAB23104, XMAB-23104,,ICOS;PDCD1,anti-ICOS;PDCD1
Reference PX-TA1675
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa
Clonality Monoclonal Antibody
Product name PX-TA1675-50
Uniprot ID Q9Y6W8 & Q15116
Source CAS 2329669-80-7
Species Humanized
Raw Antigen Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Izuralimab,IZURALIMAB, XMAB23104, XMAB-23104,,ICOS;PDCD1,anti-ICOS;PDCD1
Reference PX-TA1675
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Mixed mAb and scFv IgG1;na,Kappa;Kappa
Clonality Monoclonal Antibody

Introduction

Izuralimab Biosimilar, also known as Anti-ICOS,PDCD1 mAb, is a novel monoclonal antibody that has been developed as a biosimilar to the original Izuralimab. It targets two important immune checkpoints, ICOS and PDCD1, and has shown promising results in preclinical studies. In this article, we will discuss the structure, activity, and potential applications of Izuralimab Biosimilar in the field of immunotherapy.

Structure of Izuralimab Biosimilar

Izuralimab Biosimilar is a recombinant humanized monoclonal antibody that is composed of two heavy chains and two light chains. The heavy chains consist of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL). The variable domains of both heavy and light chains are responsible for binding to their respective targets, ICOS and PDCD1.

The amino acid sequence of Izuralimab Biosimilar has been designed to closely resemble the original Izuralimab, ensuring similar binding affinity and efficacy. The antibody has a molecular weight of approximately 150 kDa and a half-life of 21 days, making it suitable for therapeutic use.

Activity of Izuralimab Biosimilar

Izuralimab Biosimilar targets two important immune checkpoints, ICOS and PDCD1, which are known to play a crucial role in regulating immune responses. ICOS is a co-stimulatory receptor expressed on activated T cells, while PDCD1 (also known as PD-1) is an inhibitory receptor expressed on T cells and other immune cells.

By binding to ICOS, Izuralimab Biosimilar enhances T cell activation and proliferation, leading to a more robust immune response against cancer cells. On the other hand, by binding to PDCD1, the antibody blocks the inhibitory signals and allows T cells to function more effectively, resulting in enhanced anti-tumor activity.

In addition, Izuralimab Biosimilar has also been shown to have an indirect anti-tumor effect by promoting the production of cytokines, such as interferon-gamma and tumor necrosis factor-alpha, which can further enhance the immune response against cancer cells.

Therapeutic Applications of Izuralimab Biosimilar

Izuralimab Biosimilar has shown promising results in preclinical studies, demonstrating its potential as a therapeutic agent for various types of cancer. The antibody has been tested in both in vitro and in vivo models, and has shown significant anti-tumor activity against a variety of cancer types, including melanoma, lung cancer, breast cancer, and lymphoma.

The unique dual targeting of ICOS and PDCD1 by Izuralimab Biosimilar makes it a promising candidate for combination therapy with other immunotherapies, such as immune checkpoint inhibitors or adoptive T cell therapy. This approach has the potential to enhance the efficacy of these therapies and overcome resistance to treatment.

Furthermore, Izuralimab Biosimilar has also been investigated for its potential use in autoimmune diseases, such as rheumatoid arthritis and multiple sclerosis, where targeting ICOS and PDCD1 can help regulate the immune response and reduce inflammation.

Conclusion

In summary, Izuralimab Biosimilar is a novel monoclonal antibody that targets ICOS and PDCD1, two important immune checkpoints involved in regulating immune responses. Its unique structure and activity make it a promising candidate for the treatment of various types of cancer and autoimmune diseases. Further clinical studies are needed to fully evaluate the potential of this biosimilar in improving patient outcomes and advancing the field of immunotherapy.

Izuralimab Biosimilar - Anti-ICOS;PDCD1 mAb - Research Grade

There are no reviews yet.

Be the first to review “Izuralimab Biosimilar – Anti-ICOS;PDCD1 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products