Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Fanastomig Biosimilar – Anti-FDC; CD279 mAb – Research Grade

  • PX-TA2118-50
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer

Original price was: $225.00.Current price is: $167.00.

50ug 26% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade

Product name PX-TA2118-50
Uniprot ID P18627 & Q15116
Source CAS: 2761795-00-8
Origin species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2118
Note For research use only. Not suitable for human use.
Isotype Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer
Clonality Monoclonal Antibody
Product name Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source CAS: 2761795-00-8
Origin species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2118
Note For research use only. Not suitable for human use.
Isotype Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer
Clonality Monoclonal Antibody
Product name Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade
Uniprot ID P18627 & Q15116
Source CAS: 2761795-00-8
Origin species Chimeric
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >95% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Reference PX-TA2118
Note For research use only. Not suitable for human use.
Isotype Ig L-kappa-H-gamma1_G1(VH-CH1-h)_L-kappa dimer
Clonality Monoclonal Antibody

Introduction to Fanastomig Biosimilar – Anti-FDC, CD279 mAb

Fanastomig Biosimilar – Anti-FDC, CD279 mAb is a novel therapeutic antibody that has been developed as a biosimilar to the existing anti-FDC, CD279 monoclonal antibody. This biosimilar has been designed to specifically target and inhibit FDC (follicular dendritic cells) which are involved in the development of autoimmune diseases and cancer. In this article, we will provide a comprehensive overview of the structure, activity and potential applications of Fanastomig Biosimilar – Anti-FDC, CD279 mAb.

Structure of Fanastomig Biosimilar – Anti-FDC, CD279 mAb

Fanastomig Biosimilar – Anti-FDC, CD279 mAb is a fully human monoclonal antibody that is produced using recombinant DNA technology. It is composed of two identical heavy chains and two identical light chains, each containing a variable region and a constant region. The variable region of the antibody is responsible for binding to the FDC antigen, while the constant region is responsible for mediating effector functions.

Mechanism of Action of Fanastomig Biosimilar – Anti-FDC, CD279 mAb

The primary mechanism of action of Fanastomig Biosimilar – Anti-FDC, CD279 mAb is through its specific binding to FDC. FDCs are specialized cells found in lymphoid tissues that play a crucial role in the development of autoimmune diseases and cancer. By binding to FDC, Fanastomig Biosimilar – Anti-FDC, CD279 mAb prevents the interaction between FDC and immune cells, thereby inhibiting the development of autoimmune diseases and cancer.

Title: Applications of Fanastomig Biosimilar – Anti-FDC, CD279 mAb

Fanastomig Biosimilar – Anti-FDC, CD279 mAb has shown promising results in preclinical studies as a potential treatment for various autoimmune diseases and cancer. It has been shown to effectively inhibit the growth of tumors and reduce the severity of autoimmune diseases such as rheumatoid arthritis and lupus. Additionally, Fanastomig Biosimilar – Anti-FDC, CD279 mAb has the potential to be used in combination with other therapies to enhance their efficacy.

Advantages of Fanastomig Biosimilar – Anti-FDC, CD279 mAb

Compared to the existing anti-FDC, CD279 monoclonal antibody, Fanastomig Biosimilar – Anti-FDC, CD279 mAb has several advantages. Being a biosimilar, it has a similar structure and mechanism of action, but with a lower cost and improved accessibility. Moreover, being a fully human antibody, it has a lower risk of immunogenicity and adverse effects compared to other therapeutic antibodies.

Title: Research Grade of Fanastomig Biosimilar – Anti-FDC, CD279 mAb

Fanastomig Biosimilar – Anti-FDC, CD279 mAb is currently available in a research grade, making it suitable for use in preclinical studies and research. This grade of the antibody has been extensively tested for purity, potency and stability, ensuring reliable and reproducible results in experiments.

Conclusion

In conclusion, Fanastomig Biosimilar – Anti-FDC, CD279 mAb is a promising therapeutic antibody that specifically targets FDC and has the potential to treat various autoimmune diseases and cancer. Its unique structure and mechanism of action make it a valuable addition to the existing therapies for these conditions. With further research and development, Fanastomig Biosimilar – Anti-FDC, CD279 mAb has the potential to improve the lives of patients suffering from these diseases.

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig in ELISA Assay

Research Grade Fanastomig can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

Fanastomig Biosimilar - Anti-FDC; CD279 mAb - Research Grade

There are no reviews yet.

Be the first to review “Fanastomig Biosimilar – Anti-FDC; CD279 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products