Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG1, kappa

Original price was: $208.00.Current price is: $167.00.

50ug 20% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

Product name Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade
Uniprot ID P18627 & Q15116
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms anti-PD1, Programmed cell death protein 1, Protein PD-1, hPD-1, PDCD1, CD279, LAG3, LAG-3, CD223
Reference PX-TA2074
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade
Uniprot ID P18627 & Q15116
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms anti-PD1, Programmed cell death protein 1, Protein PD-1, hPD-1, PDCD1, CD279, LAG3, LAG-3, CD223
Reference PX-TA2074
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1-kappa
Clonality Monoclonal Antibody
Product name PX-TA2074-50
Uniprot ID P18627 & Q15116
Species Homo sapiens
Expression system XtenCHO
Raw Antigen Sequence MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL
Purity >90% by SDS-PAGE.
Buffer 0.01M PBS, pH 7.4.
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term; -20°C for long term
Brand ProteoGenix
Aliases /Synonyms anti-PD1, Programmed cell death protein 1, Protein PD-1, hPD-1, PDCD1, CD279, LAG3, LAG-3, CD223
Reference PX-TA2074
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG1, kappa
Clonality Monoclonal Antibody

Introduction to Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb

Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb is a novel research grade monoclonal antibody (mAb) that has been designed to target two important immune checkpoints, PD1 and LAG3. This biosimilar is a promising therapeutic agent that has shown potential in the treatment of various cancers and autoimmune diseases. In this article, we will explore the structure, activity, and potential applications of Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb.

Structure of Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb

Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb is a chimeric monoclonal antibody that is composed of both human and mouse components. It is a fully humanized antibody, meaning that it has been engineered to minimize the potential for an immune response in patients. The antibody has a molecular weight of approximately 150 kDa and consists of two heavy chains and two light chains. The heavy chains are composed of four constant domains (CH1, CH2, CH3, and CH4) and one variable domain (VH), while the light chains contain one constant domain (CL) and one variable domain (VL). The variable domains are responsible for binding to the target antigens, PD1 and LAG3.

Activity of Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb

The main mechanism of action of Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb is through the blockade of PD1 and LAG3 receptors. These receptors are expressed on the surface of immune cells and play a crucial role in regulating immune responses. PD1 is primarily expressed on T cells and inhibits their activation, while LAG3 is expressed on various immune cells and regulates their function. By binding to these receptors, Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb prevents their interaction with their ligands, PD-L1 and MHC class II, respectively. This results in the activation of immune cells and the enhancement of anti-tumor immune responses.

Title: Potential Applications of Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb has shown promising results in pre-clinical studies and is currently being evaluated in clinical trials for the treatment of various cancers, including melanoma, lung cancer, and renal cell carcinoma. It has also shown potential in the treatment of autoimmune diseases such as rheumatoid arthritis and multiple sclerosis. As a research grade antibody, Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb can also be used in laboratory studies to investigate the role of PD1 and LAG3 in immune regulation and the development of potential therapeutic strategies.

Conclusion

In conclusion, Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb is a promising research grade monoclonal antibody that targets two important immune checkpoints, PD1 and LAG3. Its unique structure and mechanism of action make it a potential therapeutic agent for the treatment of various cancers and autoimmune diseases. Further studies and clinical trials are needed to fully understand the potential of this biosimilar and its role in improving patient outcomes.

SDS-PAGE for Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

SDS-PAGE for Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Tobemstomig Biosimilar - Anti-PD1 and LAG3 mAb - Research Grade

There are no reviews yet.

Be the first to review “Tobemstomig Biosimilar – Anti-PD1 and LAG3 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products