Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD279 Recombinant Protein

  • PX-P4117-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q15116
Molecular weight:
40kDa

Original price was: $444.00.Current price is: $350.00.

50ug 21% OFF + 350 loyalty points
Met1~Val170 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD279 Recombinant Protein

Product name PX-P4117-100
Uniprot ID Q15116
Uniprot link http://www.uniprot.org/uniprot/Q15116
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV
Molecular weight 40kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Val170
Aliases /Synonyms PD1
Reference PX-P4117
Note For research use only.
Molecular Constructor
Met1~Val170 His
Product name PX-P4117-1MG
Uniprot ID Q15116
Uniprot link http://www.uniprot.org/uniprot/Q15116
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV
Molecular weight 40kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Val170
Aliases /Synonyms PD1
Reference PX-P4117
Note For research use only.
Molecular Constructor
Met1~Val170 His
Product name PX-P4117-50
Uniprot ID Q15116
Uniprot link http://www.uniprot.org/uniprot/Q15116
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTLV
Molecular weight 40kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH7.5
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition Store at - 20℃ to -80℃.It is recommended that the protein be aliquoted for optimal storage.
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1~Val170
Aliases /Synonyms PD1
Reference PX-P4117
Note For research use only.
Molecular Constructor
Met1~Val170 His

General information on CD279 Recombinant Protein:

CD279 (programmed cell death protein 1; PD-1) is a type I transmembrane protein that belongs to the CD28 / CTLA-4 family of immune receptors, which mediates signals that regulate immune responses. Members of the CD28 / CTLA-4 family have been shown to promote T cell activation (CD28 and ICOS) or deactivate T cell activation (CTLA-4 and PD-1). CD279 is expressed on activated T cells, B cells, bone marrow cells, and some thymocytes. In vitro, CD279 binding can prevent TCR-mediated T cell proliferation and the production of IL-1, IL-4, IL-10, and IFN-γ. Furthermore, the binding of CD279 can also prevent BCR signaling. CD279-deficient mice have defective peripheral tolerance and spontaneously develop autoimmune diseases.

Nivolumab Biosimilar - Anti-PD1 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay

Nivolumab Biosimilar - Anti-PD1 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Nivolumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1004) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Dostarlimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay

Dostarlimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Dostarlimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb (cat. No.PX-TA1526) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Cemiplimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Cemiplimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Cemiplimab Biosimilar - Anti-PDCD1, PD1, CD279 mAb - Research Grade (cat. No.PX-TA1524) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 905.4M.

Balstilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Balstilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Balstilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1558) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 9.940M.

Cetrelimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Cetrelimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Cetrelimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1513) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 99.31M.

Tislelizumab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Tislelizumab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Tislelizumab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1479) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 133.8M.

Sintilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Sintilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Sintilimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1536) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 44.44M.

Toripalimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Toripalimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade binds to CD279 Recombinant Protein in ELISA assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind Toripalimab Biosimilar - Anti-PDCD1; PD1; CD279 mAb - Research Grade (cat. No.PX-TA1540) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450 giving an EC50 at 46.26M.

Pembrolizumab Biosimilar - Anti-PD1 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay

Pembrolizumab Biosimilar - Anti-PD1 mAb binds to CD279 Recombinant Protein in indirect ELISA Assay

Immobilized CD279 Recombinant Protein (cat. No.PX-P4117) at 0.5µg/mL (100µL/well) can bind to Pembrolizumab Biosimilar - Anti-PD1 mAb (cat. No.PX-TA1007) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

CD279 Recombinant Protein

There are no reviews yet.

Be the first to review “CD279 Recombinant Protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products