Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Human PDL1, B7-H1, CD274 recombinant protein

  • PX-P4038-50
  • Validated ELISA
Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NZQ7
Molecular weight:
28.73kDa

Original price was: $288.00.Current price is: $250.00.

50ug 13% OFF + 250 loyalty points
Met1–Arg238 His
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Human PDL1, B7-H1, CD274 recombinant protein

Product name Human PDL1, B7-H1, CD274 recombinant protein
Uniprot ID Q9NZQ7
Uniprot link http://www.uniprot.org/uniprot/Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 28.73kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg238
Aliases /Synonyms PDL1, Programmed cell death 1 ligand 1, CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1
Reference PX-P4038
Note For research use only
Molecular Constructor
Met1–Arg238 His
Product name Human PDL1, B7-H1, CD274 recombinant protein
Uniprot ID Q9NZQ7
Uniprot link http://www.uniprot.org/uniprot/Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 28.73kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg238
Aliases /Synonyms PDL1, Programmed cell death 1 ligand 1, CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1
Reference PX-P4038
Note For research use only
Molecular Constructor
Met1–Arg238 His
Product name PX-P4038-1MG
Uniprot ID Q9NZQ7
Uniprot link http://www.uniprot.org/uniprot/Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 28.73kDa
Protein delivered with Tag? C-Terminal His Tag
Purity estimated 90%
Buffer 50 mM Tris-HCl pH 8, 150 mM NaCl
Form Lyophilized
Delivery condition Dry Ice
Delivery lead time in business days 5-7
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg238
Aliases /Synonyms PDL1, Programmed cell death 1 ligand 1, CD274, B7-H, B7H1, PD-L1, PDCD1L1, PDCD1-LG1, Programed Death Ligand 1
Reference PX-P4038
Note For research use only
Molecular Constructor
Met1–Arg238 His

General Information about Human PDL1 / B7-H1 / CD274 recombinant protein

Programmed death ligand 1 (PD-L1), also known as cluster of differentiation 274 (CD274) or B7 homolog 1 (B7-H1), is a protein encoded by the CD274 gene in humans. It is a member of the B7 family in the immunoglobulin receptor superfamily. It is expressed on T cells, B cells, NK cells, dendritic cells, endothelial cells and IFN-γ activated monocytes.
Programmed Death Ligand 1 (PD-L1) is a transmembrane protein that is believed to inhibit immune system adaptation during specific events (such as pregnancy, ectopic tissue disease, autoimmune disease, and other diseases such as hepatitis). In general, the adaptive immune system reacts to antigens associated with the immune system through dangerous exogenous or endogenous activities. In turn, clonal expansion of antigen-specific CD8 + T cells and / or CD4 + helper cells is widespread. The binding of PD-L1 to the inhibitory control molecule PD-1 transmits an inhibitory signal through the interaction of a tyrosine-based immunoreceptor (ITSM) motif with phosphatase (SHP-1 or SHP-2). This reduces the proliferation of antigen-specific T cells in ganglia and at the same time reduces the apoptosis of regulatory T cells (anti-inflammatory and inhibitory T cells), further mediated by lower regulation of the Bcl-2 gene.

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Durvalumab Biosimilar - Anti-PD-L1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Immobilized Human PDL1, B7-H1, CD274 recombinant protein (cat. No.PX-P4038) at 0.5µg/mL (100µL/well) can bind to Durvalumab Biosimilar - Anti-PD-L1 mAb (cat. No.PX-TA1002) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Pacmilimab Biosimilar - Anti-CD274, PD-L1, B7-H1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Pacmilimab Biosimilar - Anti-CD274, PD-L1, B7-H1 mAb binds to Human PDL1, B7-H1, CD274 recombinant protein in indirect ELISA Assay

Immobilized Human PDL1, B7-H1, CD274 recombinant protein (cat. No.PX-P4038) at 0.5µg/mL (100µL/well) can bind to Pacmilimab Biosimilar - Anti-CD274, PD-L1, B7-H1 mAb (cat. No.PX-TA1600) in indirect ELISA with Goat Anti-Human IgG secondary antibody coupled with HRP measured by OD450

Human PDL1, B7-H1, CD274 recombinant protein

There are no reviews yet.

Be the first to review “Human PDL1, B7-H1, CD274 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products