Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Erfonrilimab Biosimilar – Anti-CD274;CTLA4 mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
Bispecific Single Domains (VH-VH'-CH),IgG1na;na

Original price was: $221.00.Current price is: $167.00.

50ug 24% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade

Product name Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade
Uniprot ID P16410 & Q9NZQ7
Source CAS 2367013-69-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Erfonrilimab,ERFONRILIMAB, ERFONRILIMAB, KN046,CD274;CTLA4,anti-CD274;CTLA5
Reference PX-TA1665
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Single Domains (VH-VH'-CH),IgG1na;na
Clonality Monoclonal Antibody
Product name Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade
Uniprot ID P16410 & Q9NZQ7
Source CAS 2367013-69-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Erfonrilimab,ERFONRILIMAB, ERFONRILIMAB, KN046,CD274;CTLA4,anti-CD274;CTLA5
Reference PX-TA1665
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Single Domains (VH-VH'-CH),IgG1na;na
Clonality Monoclonal Antibody
Product name PX-TA1665-50
Uniprot ID P16410 & Q9NZQ7
Source CAS 2367013-69-0
Species Humanized
Expression system XtenCHO
Raw Antigen Sequence MACLGFQRHKAQLNLATRTWPCTLLFFLLFIPVFCKAMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDFLLWILAAVSSGLFFYSFLLTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3 week if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Erfonrilimab,ERFONRILIMAB, ERFONRILIMAB, KN046,CD274;CTLA4,anti-CD274;CTLA5
Reference PX-TA1665
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype Bispecific Single Domains (VH-VH'-CH),IgG1na;na
Clonality Monoclonal Antibody

Erfonrilimab Biosimilar – Anti-CD274,CTLA4 mAb – Research Grade: A Potent Antibody Targeting Immune Checkpoint Proteins Erfonrilimab Biosimilar, also known as Anti-CD274,CTLA4 mAb, is a research grade monoclonal antibody that has gained significant attention in the field of immunotherapy. It is a biosimilar version of the FDA-approved drug, Nivolumab, and is designed to target two important immune checkpoint proteins, CD274 (also known as PD-L1) and CTLA4. This antibody has shown promising results in pre-clinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer.

Structure of Erfonrilimab Biosimilar

Erfonrilimab Biosimilar is a fully human IgG4 monoclonal antibody, meaning it is derived from human cells and has four subclasses of immunoglobulin G. It is composed of two heavy chains and two light chains, connected by disulfide bonds. The antibody has a molecular weight of approximately 150 kDa and a half-life of 12-14 days in the human body.

The antibody has a specific binding site for CD274 and CTLA4, which are both immune checkpoint proteins expressed on the surface of immune cells. The binding of Erfonrilimab Biosimilar to these proteins inhibits their interaction with their respective receptors, PD-1 and CD80/86, leading to the activation of T cells and enhanced anti-tumor immune response.

Activity of Erfonrilimab Biosimilar

Erfonrilimab Biosimilar has been shown to have potent anti-tumor activity in pre-clinical studies. By targeting CD274 and CTLA4, it blocks the inhibitory signals that cancer cells use to evade the immune system. This allows the immune system to recognize and attack cancer cells, leading to tumor regression.

Additionally, Erfonrilimab Biosimilar has also been shown to enhance the activity of other immune cells, such as natural killer cells and macrophages, further contributing to its anti-tumor effects. It has also been found to have a synergistic effect when combined with other immunotherapies, such as anti-PD-1 or anti-CTLA4 antibodies.

Application of Erfonrilimab Biosimilar

Erfonrilimab Biosimilar is currently being evaluated in clinical trials for the treatment of various types of cancer, including lung cancer, melanoma, and renal cell carcinoma. It has also shown potential in the treatment of other types of cancer, such as head and neck cancer, bladder cancer, and lymphoma.

The antibody is administered intravenously and is typically given every 2-3 weeks. It has shown promising results in both monotherapy and combination therapy settings, with manageable side effects.

Conclusion

Erfonrilimab Biosimilar, also known as Anti-CD274,CTLA4 mAb, is a research grade monoclonal antibody that has shown promising results in pre-clinical studies and is currently being evaluated in clinical trials for the treatment of various types of cancer. Its unique mechanism of action, targeting two important immune checkpoint proteins, CD274 and CTLA4, makes it a promising candidate for cancer immunotherapy. With further research and development, this antibody has the potential to improve outcomes for cancer patients and revolutionize the field of immunotherapy.

SDS-PAGE for Erfonrilimab Biosimilar - Anti-CD274,CTLA4 mAb - Research Grade

SDS-PAGE for Erfonrilimab Biosimilar - Anti-CD274,CTLA4 mAb - Research Grade

Erfonrilimab Biosimilar - Anti-CD274,CTLA4 mAb - Research Grade on SDS-PAGE under reducing and non-reducing conditions. The gel was stained overnight with Coomassie Blue.. The purity of the antibody is greater than 95%.

Erfonrilimab Biosimilar - Anti-CD274;CTLA4 mAb - Research Grade

There are no reviews yet.

Be the first to review “Erfonrilimab Biosimilar – Anti-CD274;CTLA4 mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products