Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CD274 / PD-L1 / B7-H1, C-His, recombinant protein

Host species:
Mammalian cells
Origin species:
Homo sapiens (Human)
Uniprot ID:
Q9NZQ7
Molecular weight:
33.28 kDa

$500.00

100ug + 500 loyalty points
Met1–Arg238 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CD274 / PD-L1 / B7-H1, C-His, recombinant protein

Product name CD274 / PD-L1 / B7-H1, C-His, recombinant protein
Uniprot ID Q9NZQ7
Origin species Homo sapiens (Human)
Expression system Eukaryotic expression
Raw Antigen Sequence MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
Molecular weight 33.28 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% as determined by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg238
Protein Accession Q9NZQ7
Reference PX-P5607
Note For research use only
Molecular Constructor
Met1–Arg238 His

General information on CD274 / PD-L1 / B7-H1, C-His, recombinant protein

CD274 / PD-L1 / B7-H1 Structure

CD274, also known as PD-L1 or B7-H1, is a type I transmembrane glycoprotein that is expressed on the surface of various cell types, including T cells, B cells, macrophages, dendritic cells, and some tumor cells. The extracellular domain of CD274 is composed of three immunoglobulin-like domains, while the intracellular domain contains a cytoplasmic tail that is important for the regulation of its activity.

CD274 / PD-L1 / B7-H1 Activity

CD274 acts as an inhibitory receptor that binds to its ligand, programmed death ligand 1 (PD-L1). This interaction between CD274 and PD-L1 results in the inhibition of T cell activation and proliferation, as well as the induction of anergy and apoptosis in T cells. In addition, CD274 can also bind to other ligands, including B7 family members, which can lead to the activation of T cells.

CD274 / PD-L1 / B7-H1 Application

CD274 has been studied extensively in the context of cancer immunotherapy, as it is often overexpressed on tumor cells.

CD274 / PD-L1 / B7-H1, C-His, recombinant protein

There are no reviews yet.

Be the first to review “CD274 / PD-L1 / B7-H1, C-His, recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products