Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Mouse PD-1 recombinant protein

Host species:
Mammalian cells
Origin species:
Mouse
Uniprot ID:
Q02242
Molecular weight:
15.73 kDa

$356.00

100ug + 356 loyalty points
Leu25–Gln167 His
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Mouse PD-1 recombinant protein

Product name Mouse PD-1 recombinant protein
Uniprot ID Q02242
Origin species Mouse
Expression system Eukaryotic expression
Raw Antigen Sequence LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPE
Molecular weight 15.73 kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >85% by SDS-PAGE
Buffer PBS, pH7.5
Delivery condition Dry Ice
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Leu25-Gln167
Aliases /Synonyms Pd1, CD279
Reference PX-P6064
Note For research use only
Molecular Constructor
Leu25–Gln167 His

General information on Mouse PD-1 recombinant protein

Structure of Mouse PD-1 Recombinant Protein

Mouse PD-1 is a type I transmembrane glycoprotein and a member of the CD protein family. It is composed of an extracellular domain, a single transmembrane domain, and a cytoplasmic domain. The extracellular domain is composed of two Ig-like domains and a short stalk region.

Activity of Mouse PD-1 Recombinant Protein

Mouse PD-1 is an immune checkpoint protein that plays an important role in regulating the immune system. It binds to its ligands, PD-L1 and PD-L2, to inhibit T-cell activation and suppress the immune response.

Application of Mouse PD-1 Recombinant Protein

Mouse PD-1 recombinant protein is used in research to study the role of PD-1 in immune regulation and the development of novel therapeutics for autoimmune and cancer diseases. It is also used in the development of diagnostic tests to detect the expression of PD-1 in cells.

Mouse PD-1 recombinant protein

There are no reviews yet.

Be the first to review “Mouse PD-1 recombinant protein”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products