Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Palivizumab ELISA Kit

$1,403.00

96T + 1403 loyalty points
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery
Palivizumab ELISA Kit

Palivizumab ELISA Kit

Product name Palivizumab ELISA Kit
Uniprot ID P03420
Raw Antigen Sequence MELLILKANAITTILTAVTFCFASGQNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPPTNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRFLGFLLGVGSAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEINLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGMDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLHNVNAGKSTTNIMITTIIIVIIVILLSLIAVGLLLYCKARSTPVTLSKDQLSGINNIAFSN
Delivery condition Blue ice (+4°)
Storage condition The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 10% prior to the expiration date under appropriate storage condition.
Brand ProteoGenix
Size 96T
Reference KPTX284
Note For research use only.
Sample type Plasma, Serum
Target Palivizumab
Immunogen Palivizumab

Introduction to Palivizumab ELISA Kit

Palivizumab ELISA Kit is a highly sensitive and specific enzyme-linked immunosorbent assay (ELISA) used for the detection and quantification of Palivizumab in biological samples. Palivizumab is a monoclonal antibody that is used as a therapeutic target for the prevention of respiratory syncytial virus (RSV) infection in high-risk infants. This ELISA kit is widely used in both research and clinical settings for its accurate and reliable results.

Structure of Palivizumab

Palivizumab is a humanized monoclonal antibody that is derived from a mouse antibody. It is composed of two heavy and two light chains, each containing a variable and a constant region. The variable region of the antibody is responsible for binding to the RSV fusion protein, while the constant region mediates effector functions such as complement activation and antibody-dependent cellular cytotoxicity.

The structure of Palivizumab is designed to specifically target the RSV fusion protein, which is a key component of the virus responsible for its entry into cells. By binding to this protein, Palivizumab prevents the virus from attaching to and infecting cells, thus providing protection against RSV infection.

Activity of Palivizumab

Palivizumab is a highly potent and specific antibody that has been shown to effectively neutralize RSV in vitro and in vivo. It has a high binding affinity for the RSV fusion protein, which allows it to effectively block viral entry into cells. In addition, Palivizumab also has the ability to activate the immune system through its constant region, leading to the destruction of RSV-infected cells.

The activity of Palivizumab has been extensively studied and proven in clinical trials. It has been shown to significantly reduce the incidence of RSV infection in high-risk infants, including premature babies and those with underlying medical conditions. This makes it an essential therapeutic target for the prevention of severe RSV disease in vulnerable populations.

Application of Palivizumab ELISA Kit

The Palivizumab ELISA Kit is a valuable tool for both research and clinical use. In research settings, it is used to measure the levels of Palivizumab in biological samples, such as serum or plasma, to assess the effectiveness of the antibody in preventing RSV infection. It is also used to study the pharmacokinetics and pharmacodynamics of Palivizumab, which can aid in the development of new and improved treatments for RSV infection.

In clinical settings, the Palivizumab ELISA Kit is used for the quantitative determination of Palivizumab in patient samples. This is important for monitoring the levels of the antibody in high-risk infants who are receiving Palivizumab as a prophylactic treatment. It can also be used to assess the effectiveness of the treatment and make necessary adjustments to the dosage or frequency of administration.

Conclusion

The Palivizumab ELISA Kit is a highly sensitive and specific assay that plays a crucial role in the prevention and treatment of RSV infection. Its accurate and reliable results make it an essential tool for both research and clinical use. With the increasing prevalence of RSV infection, the Palivizumab ELISA Kit will continue to be an important asset in the fight against this respiratory virus.

Palivizumab ELISA Kit

There are no reviews yet.

Be the first to review “Palivizumab ELISA Kit”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products