Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade

  • PX-TA1088-100UG
  • Validated ELISA WB
Clonality:
Monoclonal Antibody
Isotype:
F(ab')2-G3-kappa

Original price was: $321.00.Current price is: $238.00.

100ug 26% OFF + 238 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

Product name Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 156227-98-4
Species Mus musculus
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms Afelimomab,MAK-195F,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1088
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype F(ab')2-G3-kappa
Clonality Monoclonal Antibody
Product name Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Source CAS 156227-98-4
Species Mus musculus
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms Afelimomab,MAK-195F,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1088
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype F(ab')2-G3-kappa
Clonality Monoclonal Antibody
Product name PX-TA1088-50
Uniprot ID P01375
Source CAS 156227-98-4
Species Mus musculus
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms Afelimomab,MAK-195F,TNFSF2, TNF-alpha, TNFA,anti-TNFSF2, TNF-alpha, TNFA
Reference PX-TA1088
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype F(ab')2-G3-kappa
Clonality Monoclonal Antibody

Introduction

Afelimomab Biosimilar, also known as Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade, is a monoclonal antibody that targets TNFSF2, also known as tumor necrosis factor-alpha (TNF-α). This biosimilar is a highly specific and potent therapeutic agent that has been developed for the treatment of inflammatory diseases and autoimmune disorders. In this article, we will discuss the structure, activity, and potential applications of Afelimomab Biosimilar.

Structure

Afelimomab Biosimilar is a recombinant humanized monoclonal antibody that is produced in a mammalian cell expression system. It is composed of two identical heavy chains and two identical light chains, each containing a variable and constant region. The variable region of the antibody is responsible for binding to TNF-α, while the constant region determines the effector functions of the antibody.

Activity

TNF-α is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various inflammatory diseases and autoimmune disorders. It is produced by activated immune cells and can cause tissue damage and inflammation. Afelimomab Biosimilar binds to TNF-α with high affinity, preventing it from binding to its receptors and exerting its inflammatory effects. This leads to a decrease in inflammation and tissue damage, providing relief to patients with inflammatory diseases.

Therapeutic Target

The therapeutic target of Afelimomab Biosimilar is TNF-α, a cytokine that is involved in the regulation of immune responses and inflammation. TNF-α is known to play a critical role in the pathogenesis of various diseases, including rheumatoid arthritis, psoriasis, Crohn’s disease, and ulcerative colitis. By targeting TNF-α, Afelimomab Biosimilar offers a promising treatment option for these diseases.

Potential Applications

Afelimomab Biosimilar has the potential to be used in the treatment of various inflammatory diseases and autoimmune disorders. It has been shown to be effective in clinical trials for rheumatoid arthritis, psoriasis, and Crohn’s disease. In addition, this biosimilar has also been investigated for its potential in treating other conditions such as ankylosing spondylitis, ulcerative colitis, and psoriatic arthritis.

Rheumatoid Arthritis

Rheumatoid arthritis (RA) is a chronic autoimmune disease that causes inflammation and destruction of joints. TNF-α is known to play a key role in the pathogenesis of RA, and Afelimomab Biosimilar has been shown to effectively reduce disease activity and improve symptoms in patients with RA. It is administered as an intravenous infusion and has been well-tolerated in clinical trials.

Psoriasis

Psoriasis is a chronic inflammatory skin disorder that is characterized by red, scaly patches on the skin. TNF-α is believed to play a significant role in the development of psoriasis, and Afelimomab Biosimilar has shown promising results in clinical trials for this condition. It has been shown to improve symptoms and quality of life in patients with moderate to severe psoriasis.

Crohn’s Disease

Crohn’s disease is a chronic inflammatory bowel disorder that affects the digestive tract. TNF-α is known to play a critical role in the pathogenesis of Crohn’s disease, and Afelimomab Biosimilar has been shown to be an effective treatment option. It has been shown to induce and maintain remission in patients with moderate to severe Crohn’s disease.

Conclusion

In conclusion, Afelimomab Biosimilar, also known as Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade, is a highly specific and potent therapeutic agent that targets TNF-α. It has shown promising results in clinical trials for the treatment of various inflammatory diseases and autoimmune disorders. With its potential to improve the lives of patients suffering from these conditions, Afelimomab Biosimilar is a promising addition to the arsenal of treatments available for these diseases.

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade in ELISA Assay

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade can bind to its target in indirect ELISA with Goat secondary antibody measured by OD450.

SDS-PAGE for Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

SDS-PAGE for Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade

Afelimomab Biosimilar - Anti-TNFa;TNF-alpha mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

Afelimomab Biosimilar - Anti-TNFSF2, TNF-alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “Afelimomab Biosimilar – Anti-TNFSF2, TNF-alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products