Skip to main content

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Brand: ProteoGenix

CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade

Clonality:
Monoclonal Antibody
Isotype:
IgG4, Kappa

Original price was: $213.00.Current price is: $167.00.

50ug 22% OFF + 167 loyalty points
Size
  • In Stock
  • Wide range of unique reagents
  • Fast worldwide delivery

CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade

Product name CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Species Humanized
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB
Aliases /Synonyms CDP571,B3 (dsFv) -PE38,LMB-9 BAY 103356,BAY W 3356,CDP571,TNFSF2, TNF alpha, TNFA,anti-TNFSF2, TNF alpha, TNFA
Reference PX-TA1154
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade
Uniprot ID P01375
Species Humanized
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Applications ELISA,WB,,,
Aliases /Synonyms CDP571,B3 (dsFv) -PE38,LMB-9 BAY 103356,BAY W 3356,CDP571,TNFSF2, TNF alpha, TNFA,anti-TNFSF2, TNF alpha, TNFA
Reference PX-TA1154
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4-kappa
Clonality Monoclonal Antibody
Product name PX-TA1154-50
Uniprot ID P01375
Species Humanized
Raw Antigen Sequence MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Purity >85%
Buffer PBS buffer PH7.5
Delivery condition Blue ice (+4°C)
Delivery Time 3-5 days if in stock; 3-5 weeks if production needed
Storage condition store at -80°C
Brand ProteoGenix
Aliases /Synonyms CDP571,B3 (dsFv) -PE38,LMB-9 BAY 103356,BAY W 3356,CDP571,TNFSF2, TNF alpha, TNFA,anti-TNFSF2, TNF alpha, TNFA
Reference PX-TA1154
Note For research use only. Not suitable for clinical or therapeutic use.
Isotype IgG4, Kappa
Clonality Monoclonal Antibody

Introduction:

CDP571 Biosimilar, also known as Anti-TNFSF2, TNF alpha, TNFA mAb, is a research grade antibody that targets TNF alpha, a cytokine involved in inflammation and immune response. This biosimilar is a potential therapeutic option for various inflammatory and autoimmune diseases. In this article, we will discuss the structure, activity, and application of CDP571 Biosimilar in detail.

Structure of CDP571 Biosimilar:

CDP571 Biosimilar is a monoclonal antibody (mAb) that is produced by recombinant DNA technology. It is a biosimilar of infliximab, a well-known anti-TNF alpha mAb. The structure of CDP571 Biosimilar is similar to that of infliximab, with a few minor differences. It is a chimeric antibody, composed of both human and mouse components. The variable regions of the antibody are derived from the mouse, while the constant regions are of human origin. This structure allows for a high binding affinity to TNF alpha, while minimizing the risk of immunogenicity.

Activity of CDP571 Biosimilar:

CDP571 Biosimilar works by binding to TNF alpha and inhibiting its activity. TNF alpha is a pro-inflammatory cytokine that plays a crucial role in the pathogenesis of various inflammatory and autoimmune diseases, including rheumatoid arthritis, psoriasis, and Crohn’s disease. By binding to TNF alpha, CDP571 Biosimilar prevents it from binding to its receptors and triggering the inflammatory response. This results in a reduction of inflammation and associated symptoms.

Application of CDP571 Biosimilar:

CDP571 Biosimilar is currently being studied for its potential use in the treatment of various inflammatory and autoimmune diseases. It has shown promising results in clinical trials for rheumatoid arthritis, psoriasis, and Crohn’s disease. In addition, CDP571 Biosimilar has also been evaluated for its use in other conditions, such as ankylosing spondylitis, ulcerative colitis, and psoriatic arthritis.

Rheumatoid Arthritis:

Rheumatoid arthritis (RA) is a chronic inflammatory disease that primarily affects the joints. It is characterized by joint pain, stiffness, and swelling, which can lead to joint deformity and disability. TNF alpha is a key player in the pathogenesis of RA, and its inhibition by CDP571 Biosimilar has shown to be effective in reducing the signs and symptoms of the disease.

Psoriasis:

Psoriasis is a chronic autoimmune skin disorder that is characterized by red, scaly patches on the skin. TNF alpha is believed to play a crucial role in the development of psoriasis, and CDP571 Biosimilar has shown to be effective in reducing the severity of the disease. It has also been shown to improve the quality of life of patients with psoriasis.

Crohn’s Disease:

Crohn’s disease is a chronic inflammatory bowel disease that can affect any part of the digestive tract. It is characterized by abdominal pain, diarrhea, and weight loss. TNF alpha is known to contribute to the inflammation in Crohn’s disease, and CDP571 Biosimilar has shown to be effective in reducing the symptoms and maintaining remission in patients with this condition.

Ankylosing Spondylitis:

Ankylosing spondylitis (AS) is a chronic inflammatory disease that primarily affects the spine. It is characterized by back pain and stiffness, which can lead to a loss of mobility. TNF alpha is believed to play a role in the pathogenesis of AS, and CDP571 Biosimilar has shown to be effective in reducing the symptoms and improving spinal mobility in patients with this condition.

Ulcerative Colitis:

Ulcerative colitis (UC) is a chronic inflammatory disease that affects the colon and rectum. It is characterized by abdominal pain, diarrhea, and rectal bleeding. TNF alpha has been implicated in the pathogenesis of UC, and CDP571 Biosimilar has shown to be effective in reducing the symptoms and maintaining remission in patients with this condition.

Psoriatic Arthritis:

Psoriatic arthritis (PsA) is a chronic inflammatory disease that affects

SDS-PAGE for CDP571 Biosimilar - Anti-TNFSF2; TNF alpha; TNFA mAb - Research Grade

SDS-PAGE for CDP571 Biosimilar - Anti-TNFSF2; TNF alpha; TNFA mAb - Research Grade

CDP571 Biosimilar - Anti-TNFSF2; TNF alpha; TNFA mAb - Research Grade, on SDS-PAGE. The gel was stained overnight with Coomassie Blue. The purity of the antibody is greater than 95%.

CDP571 Biosimilar - Anti-TNFSF2, TNF alpha, TNFA mAb - Research Grade

There are no reviews yet.

Be the first to review “CDP571 Biosimilar – Anti-TNFSF2, TNF alpha, TNFA mAb – Research Grade”

Your email address will not be published. Required fields are marked *

Related products

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call

Cart (0 Items)

Your cart is currently empty.

View Products